SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|149523|GID1.0040212 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|149523|GID1.0040212
Domain Number 1 Region: 754-880
Classification Level Classification E-value
Superfamily Second domain of FERM 1.18e-24
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 2 Region: 274-390
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-22
Family Second domain of FERM 0.00029
Further Details:      
 
Domain Number 3 Region: 949-1028
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-18
Family Third domain of FERM 0.0028
Further Details:      
 
Domain Number 4 Region: 391-478
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000125
Family Third domain of FERM 0.0055
Further Details:      
 
Domain Number 5 Region: 596-646
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000533
Family Ubiquitin-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|149523|GID1.0040212
Sequence length 1049
Sequence
MEYNNQDLQKIPLPLIEKLINFMVYRLHPNHLSLQTISKPIKIKLVRQNRVITMRFSIYS
TIDKIINQIYERVLNEERMEIIEKQKNLSSNNLLSLVNNNLNNNNNITTTTTTTTTTTTT
ATTTANKLTSSTWGTIENYGLFQQSGSFRNARWLQLDKTLAFYEIDSNETLEFKTTKNVL
KIRFFGPWERVVHPLHQSTMLLDETIKTFVIDESKTVSEISADLAKKLQLKYPEELSLKR
QCEEDDTRGVWLSSDLALPEQNIDPLYTIFLLKRQFFFCKDIIIDFSMDPEMSHFVFCQC
LDAIIDSSHPCTQTESILFAALQCQISFGDYVANSKEMDQIRLKDFLPLEYTYQKGILKE
ILIQYQRLAGMSEQKAKLNYIQLAKSLKTYGYTFFRVISRSIQSSQPQSQLFGISPEAIL
ILDPESSKTINLYSLSNIKKWQILNNVFSIEFNDKKESFISNEAEAISHVLSSYIHYSLR
NTPSIQKQWDQNYISVGRNSLTSRKRLSTCSNCSNDSVDYDQPTSKKDNRWKYQDNLILK
KCHLYIEPKKLYINPLSTQINGSMVSKELNKDNKVTKVLKVLTDLSSKMILSFSKTSPAK
EREIVVRFSDKKVKSFIVDEQKTVAEITQEIGLKLGIKNTEEFSLQVIGNCNNSNSSFSS
GNSMNNINSNDINSSVNNSVLYNSYIVNSSNLNLNSLNTNVNNSNNSSFSNSNNHHHLNS
SNDDSILSNGGIWLKPYQPLSEQSILPDAKLMFKKKFYSSDIGAADDCNSDPVYFNLLFF
QSKDAIISNTYTCSKDEAIQLAATLFQINFGDHNPNIHKPGFLKSQDLKFFLPPNSLEFY
GLSFQKIEKSIYKEHQNLRGIKEVYAKYRYVQLCRSLKTFGAIFFSVRQLITKSESRSSS
LSSLSSSSSSPLSITSSIIGAGSVITGGGNNSSGSSGSGSSGSSSPTMIPYNQPLLLGFS
RKCILFMTAKNKKFLVEYPLSHLKRWAYHKDLQTFTLDFGDYEEGRLLFQTNECEEISQY
LSDYIDYIQTKLVGSQSFSSSIYNDKENK
Download sequence
Identical sequences F0ZDZ1
jgi|Dicpu1|149523|GID1.0040212 XP_003285635.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]