SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|149915|GID1.0040604 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|149915|GID1.0040604
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000221
Family Ubiquitin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|149915|GID1.0040604
Sequence length 52
Sequence
MVEFKVKVGTLTHGVVTVSVSSEDTIASLKDRLVGPTGAPIDQQIILLNGSL
Download sequence
Identical sequences F0ZEZ7
jgi|Dicpu1|149915|GID1.0040604 XP_003285994.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]