SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|153372|GID1.0044061 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|153372|GID1.0044061
Domain Number 1 Region: 142-226
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 2.09e-19
Family Surp module (SWAP domain) 0.00041
Further Details:      
 
Domain Number 2 Region: 586-684
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-18
Family Ubiquitin-related 0.00048
Further Details:      
 
Domain Number 3 Region: 5-63
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 1.7e-16
Family Surp module (SWAP domain) 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|153372|GID1.0044061
Sequence length 686
Sequence
MVSEIITPEGDLKNIIDKTAQYAAKLGESFETKVRNKEGHNPKFNFMKEGDIHYSYYRNK
INENKDALAKAAAPAPTTAKPAQATSTTPAVAPQPNTDTASAAIPNIAPVPTVSPHQPNI
APVPILMPHQQPPQQQSPPPPPPKKEPTLPDPLLYILDVPDFMTPLELDTIRLTAQFIAK
NGESFYNELLNRESKNNQFDFLKPTNHLYEWFRALVESYSDVIYPPANIKEKLQTPEFTD
KQVILERSMNRFEYNQKIELEKQKAEEKEDEEKSMIASIDWHDFVIVDTIEFNEEDLEDL
PPPKTFEQLLNGDILGVEEDQNDNQDVEMDVEMDMGEDDMDQDEQPEQPEQSSSNKVDQS
KLKIVKDYQKTVSKPQNQPKRTQICHFCKQEIPLDEMQEHMRIELIQKQQRDKSGGSQGG
VMMNTLTQDEDIARNLQSFASKRSDIFGEVDGSKRPQEPQDQPQKIIWDGHSGSIPKVQA
AMMAASQQKQQQHQQQTPQPKPPQHATIPHQPHHHLQQPQMQLPPQSLLPHLQQQPIVPP
GVGMPPNMVPPPFGIPGMMPPPPFGIPGMMPPPPPSNMILEEPNSKKVKKDENLIPEQIF
LQANPGPVTLNIESPEKTFQLTVHPTDLISTLKEKIKDINGMATNKQKLQAAGLSVLKDT
CTIAYYNLKSNSTINLSVKERGGKKK
Download sequence
Identical sequences F0ZNQ8
XP_003289058.1.95606 jgi|Dicpu1|153372|GID1.0044061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]