SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|155301|GID1.0045955 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|155301|GID1.0045955
Domain Number 1 Region: 2047-2343
Classification Level Classification E-value
Superfamily BEACH domain 5.36e-122
Family BEACH domain 0.00000000864
Further Details:      
 
Domain Number 2 Region: 2460-2698
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-19
Family WD40-repeat 0.0039
Further Details:      
 
Domain Number 3 Region: 331-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000187
Family Clostridium neurotoxins, the second last domain 0.027
Further Details:      
 
Domain Number 4 Region: 1940-2036
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000387
Family PreBEACH PH-like domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|155301|GID1.0045955
Sequence length 2782
Sequence
MSSSPLKYQQQFNNRVINVSGGSNSSAGNNDDIMYKYENEKFIVKQLFDQLLGIENNQHQ
TQNSSSNNSSNINNNNRNKSNIVMGSGQFNNSNNNNNSSIENYGNNKYIIKNFSKIYEII
ELLKNDDISSFLKIKILDQLIQILSYSSNNTINLILNLNQTIPKIIKKKPKTSNNSNNNI
TNISGIRKSIGVNYLVDSNLCNNSDNENYEEEEKEDNDDDSNNEEFKEKYKGHKERRKSK
TLYTNKSLVVLDELIQLLPTIDDENISLKTLQLIEILGTEHITVKQVRRIFRLFDKNYLL
THYKPNHYFLQNGLPNLFKSLDVMTFRKTPSSVFYLNGINSGLIVDPIGKVPSSGYTIST
WINIESFQHDNSESIKVYEPRLFSFLNEGGAGLESFFENGKLIFRVNSKVKTVICDQEFP
TNKWNHLIITHVPTKKWGIVPGASPLTVYLNGKMIFSQNVKYPSTSKNLNVCSIGTVPSS
NLISPTSSNGFTHIASNQSECCLKCQLGSFSMLSTSFSDSDAQDLIKKGSNYIFKKQKFV
IFTFSPKSFYGGVCHGLGNRELDNSINAFSIGDLKIFSTFSIKDSVYLIGGPQIIFPLLQ
SIEDQFKFKAASNQTISASSPSLSSTQYHVPSPPTNSSSSSIISNSSSSSSSSNNYNTNL
IQTATFKGSQEDINQLSKLINYPRVSSILRFITHLLINDKYNQNEVLKSSGISMLGHLMS
RLFSNSEDPNHPYNTNTLEREEFDLIFDSLDQLTDICFDKNPIALLKLNIYREIIFNFNI
WINIKKEYQIQLFNLIIFKVSQDPQYFRENIKVRYLLDCIKYYYHINEKQLKQQELNKKK
NNNNSNSNNNGNNNDEPIVLNYLHNHLTSDGLKEIISYIFDIIKIIIKPVLNEKEVPEIQ
EIIRFILDSECNSIVIKESLMIILYNLFLPVSNQTNQQQQQQQQGANSQQTPSPVYDDRF
LNYDTIRGFLNSFEAFGDIRSLLGLLKHDNEQVQVLVIKIIGKYMNIAECIANGSSGNVK
RHSTLLKKSSFDDYLYFIGDQLIEFEMTDLIYRGLSEIVTDNITPSIADTPNSPLLELVG
NETLGPSNNSSSNKDSNQKNKLQRKINVTALEVICKLAFKAPYVLQQKILNEILLCIKHL
PQLRAGILDRENWQNWLLSLWPTPRSNTSSPPWSPPISPTLNSSNSKAFSPPSNSEDLEQ
RHQSLSESRRIYNEQVSNRTCQSGIKEILTGIMKVLLFDCINKKEGWKFIEETEAWISSL
LPNGVPLERRIFYECLLNLERGLKSSTDTNTSSILLKNYVNLVSIIEDFVFSHTMNILSH
RNTQSQWEDFGVVAKLLDIFDISQSIQTVRIQSNVVKQMNPFQSTGVVSSGQSPTGSMSL
SPYIMTLAHNSGTIDLPSIDVTSGSAKAKSSIHTIYRLCLCIFQEAESCFYGERESYNLS
QRDPHSENADDDERNFAIRVWGLPMICEDMDQIISKNSIRIQTILASERDQKEQVKHVMW
IVCSLITIIRRHRENHTDKIIMNTQSIIISLLKSLLKTYGDLIDNFICPPNILAPIADSI
NKTITGNSSSTNNLNSTFAVHTILSLNEPQNESHPEFMKYFKDKLLQKITLLDKLHEIKD
HYETAHLSSAFTMTRRNKVSETIKGNNNKQQSVIAYRAQKLLAKSISASQKYEFQEIQHK
NDFEEYVLQYRIYLDRLWDKQFKDLTKEPSPWHEMEPRHFEKTIWKLYNFSNSNRIHILL
KQDYDGTNHPGAALSNQQQYNVHNSSPIIKQTQDEQLKNNPVLRKVINLNNSSSGLSAIG
NVGSQMEQSIESTDLTQGLVGFEMDDTNIVLDEAHETDWYLVDEQTSNRNIIKSKPTNSP
TVSNHLVNNSADNSPNSTTNPTSIATNLSTGSLTPTEGFKNISLISSSSNSSTILTNQLT
QLNPKRTNSSNSNKKSILEFSAQGEIIKPMMVIRVKMSIYTDKIVFSPTQSQEDNCIPDK
YFKEKEYDIKKLIGVQNRRYLLLPTALEFFFIDRKSVLVNFPHGSIVLKIMKLLGSLSGT
NEIIFKINNFDSNLSPQQLVIKYLNPTARWKKREISNFEYLMTLNTIAGRTYNDLNQYPV
FPWIISDYNSSKLDLNDPKVYRDLSKPIGALNPTRLEHFMERWTQCPDEIPRFMYGTHYS
SSGSVLFFLMRSEPFTSHFIKLQSGQFDHADRMFDSIIDCWRNCLNSSSDVKELTPEFFY
LPEFLINRNGVEFGVKQNGKAMNDVVLPPWAPTPHHFIMINRMALESEYVSRNLHHWVDL
IFGFKQKGKEAIQAHNVFYHLTYEGSVDIGAMSDPILREATRVQINNFGVTPSQLFTTPH
PSRDPPNQKFNSKLEIFKKLKPLQLISLPFSPLCIFVYGPSSNRDSMTVGSSLISGVVGG
GSNQLGDRILVIGEANNDFQYYRYLESNISAAAGFMTQSITPLSQNIPLSLSLGLRSVIG
KPFCQIPGNSKLLLSSGKCDNTLHVIHGDSKLTTGPISHKSAITCIAYDEHQCGRLGVGG
IIVEQRVIVTGSDDSTAIIWELDSSDYSVKPVHILRGHNFGITCISINKSNDICLTAGKD
GKVLVHSIKKGTFFKSIEHPNKLPIHSMIFCAESSSIFIYSNTIISSNSTFSSSTRSPLA
NSDSTEWNNVLYRFSINGDLIQSVLNDVQPTIVKMLITKSQNGIRYLLSAGGYQIVVREM
LNLEIVHVFDIRDLSGFTSSNRIVDLYLWGSDESYQKPSTNSNSNDNSQQNISNLVLMVP
LESCQLLIYSLDESGNLKSLSD
Download sequence
Identical sequences F0ZTM1
XP_003290771.1.95606 jgi|Dicpu1|155301|GID1.0045955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]