SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|156240|GID1.0046894 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|156240|GID1.0046894
Domain Number 1 Region: 915-1282
Classification Level Classification E-value
Superfamily RNI-like 2.01e-55
Family 28-residue LRR 0.0016
Further Details:      
 
Domain Number 2 Region: 617-733
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-21
Family Second domain of FERM 0.00037
Further Details:      
 
Domain Number 3 Region: 1286-1373
Classification Level Classification E-value
Superfamily RNI-like 0.000000000471
Family Rna1p (RanGAP1), N-terminal domain 0.095
Further Details:      
 
Domain Number 4 Region: 540-618
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000281
Family First domain of FERM 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|156240|GID1.0046894
Sequence length 1390
Sequence
MESVEDDLEQLLNELTSPNILNNISEKLKQSEPSEFSENHSNHNHNHNHGYNQNINHAQQ
YYQTNFDDETGSNAEDVRRLLEETDSNYGGSTVHSMNTTPNLYSMRNLLHTELSLDALKP
VSENSPLHMSATRPVSTSVRLPRLSICEEDDSELSSDDVSSSDSDYDDDSSTSSSLSLRN
YNNAADNNVQIKDDDSDMESSESSEQYGSPSNQRRKEILKLEKQIQIQEKKRILKEKIQE
QDDAAAEELSLNKASASTTATVTTTTTSTTTTTIISDSLPPVPSSSKSRSVSVSSNHEVS
HPISKERKRSILQSFEEGSPLRSSSRLPSSRGGSIKIKVSKVLEEEIQLQQEFEKQEQIR
NSARLSQVIRELNMSTIFDQKSDDGETKQEESQQEEPQQEKVKTLTPEEEEIEIAKQEAI
ERMREQVFSQLDLLEDPIKATAKLSSKAGEPSKKDQDSEASASSPTLEPSTVIPLPGNQA
NRFLNTQTRPRKDSISDRWDIGRKEQPRRSMTLHIQRVGEDFSVKRQEVKKVNAELEKIL
VHISLVDQSHKVICITEDFLVQDVILLFAEKLGLVQTEFFSLAEVTVDGYDRWLDPTKLV
KEAGIKNLSKLVFKIKYFKQPKRLSDSKAVHLYYLQIQQSVVSGTYPCSEAMSFRLAALQ
FYITFGAHDKEKHAPGFLDSGSLSEFIPEAFFFELPDEIIQKRLFLLHSQIKCSSVIEAK
LRYLDLSNKIPTFGVTSFQVHDGVRESSIARHKRNLCVAEDGVLISRKDRAGYDFFSYKE
IIGYQVTTRGLKIQIPHSSVTPNTSENISFDTSSYEQSANIVELMSGYKYFIQHDEFIRG
IGSPIEKVDLNISVLLPLFQSPKVRTKSDPLRSRLELFKINYLTLCQNFHTKPILKLIEQ
IDHVLDKEGGFRENLNYDKIELPSLNLKGSDLSFIADALKDSLNTVIEEGESIVENLNIL
TLDLSTNQMLALDAFEPLKIIMTCNTIVHLNLKNIGLPNKLVMSLVTIIEKYPKIETLNI
SKNRIDESGVRVILRAIKNFNKNIETLGFEDINLTDSGCKVIEKLLSNNKTLKSLNISKN
KISEAGFKIIFEGIKKATNLQDLNISGNPIQSKIMTKFIKYIASSETAIQKLNIGNTGLN
TGLGSEIQKYLVSTSCHLTSLDVAYNNLGADGTKNIIKGVVNNHIINDLSLSANKIDYNG
CNELCNLLELSSANTKTLYIRYCELSSRSLVRVCKMLELNATINVLDLSMNKFSKQTATA
IAHSLERNRTLEDLFLTQASMSHTEIDIISAGIQKNQKIKRLFLDVNPIGKKGINSLAQM
VNNNTSLEALGLRNTNLNSKDILEFLKQLNQNISIKTINLTENNLEKITQQTKLLISDQL
KRLQQVNIQY
Download sequence
Identical sequences F0ZW30
XP_003291629.1.95606 jgi|Dicpu1|156240|GID1.0046894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]