SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|35121|e_gw1.160.53.1 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|35121|e_gw1.160.53.1
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000533
Family Ras-binding domain, RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|35121|e_gw1.160.53.1
Sequence length 67
Sequence
DVVIKVFFADGSYKSMRVNEDDTTKQVIETILQKVTFTKTNGLLLYTASRETNCKYHQYH
IIIILFY
Download sequence
Identical sequences F0ZNW8
XP_003289098.1.95606 jgi|Dicpu1|35121|e_gw1.160.53.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]