SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|77947|fgeneshDP_pg.C_scaffold_88000013 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|77947|fgeneshDP_pg.C_scaffold_88000013
Domain Number 1 Region: 4-119
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-39
Family GABARAP-like 0.0000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|77947|fgeneshDP_pg.C_scaffold_88000013
Sequence length 121
Sequence
MVATSFKSETPFEKRKEISDRIKSKYADRIPVIVEKAPKSDAPDLDKKKYLVPNDITIGK
FIYELRKNTASKVNAEKAIYLFINNTIPPTAALMSQIYERYKDEDGFLYITYSGENTFGF
N
Download sequence
Identical sequences F0ZI38
jgi|Dicpu1|77947|fgeneshDP_pg.C_scaffold_88000013 XP_003287089.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]