SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|98163|estExt_fgeneshDP_pg.C_1510018 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|98163|estExt_fgeneshDP_pg.C_1510018
Domain Number 1 Region: 1296-1652
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.14e-89
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000158
Further Details:      
 
Domain Number 2 Region: 763-838
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000219
Family Ubiquitin-related 0.021
Further Details:      
 
Domain Number 3 Region: 125-278,324-471,499-543,1040-1172,1384-1411
Classification Level Classification E-value
Superfamily ARM repeat 0.0000106
Family Armadillo repeat 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|98163|estExt_fgeneshDP_pg.C_1510018
Sequence length 2851
Sequence
MTERERDIRHFVDYLKANNEYKDSIKVVDFLFEQLKNDDNFIHNFERFSEFIEVLWFRVN
QFHNQDFISKVDQLFKVIISIILNKLETEDFSTENLKTLNLIFSPKTSQYREYRYQDNEN
DLPNKLATHEAIDFYSRDGLMHLINRVKDTKYSFENIKKFVNTIKKLSKKVEKIDLSQIN
ILVKLVFDRIFSATDEEFKNENKKDLDLIIKHLYGIVNNINADTTNLQELIHNNGLQVSL
KCFKSPSLFQRNAGLNDIIRFCKSESPLPRQLHHYVPPNKIVEWLKENNVIELLYGETMH
IQLLQKCTDILKFIAEQKAFDRKYLDLIWNASEGKHETIENAIYETIGSIAPLLPPEDVD
YLFEKIQLIPFSHYTVQTLHLVRSLTQRISSDADYIPKGLEIFWNLIQDECDINLELSEM
SLNILQDSIHYFPRQRVEYLKKCIKNIEDHHSVILSLRLLYHLIGSLAERKKRNQMGGMM
MMNNNNNDNNENEMSQIIEQIDNTYHLVELLYNHLVYYNRICLDILKEKYSQVMNLDNTA
SVIPLTCDEIIFTGRYPNFSQIHDSLNFIRFIYEKSPIQMSQKHVDVLWDIFVVSPISIQ
DRSTFFNWTVEYLQFDDEQVYHFMEKFHLLPFNDLDLSGFNFYTFCMNLIKQNNNNNQYN
NNNNNNNNQQQQTTIVGLDDLWRVLIEARNEEVGRAACTFLIEQYKEFKNPKEFLNTCMH
KLSTVPIQNNGTSLDQELLVQRCLSLIKRYLEDFGSRIPGSFKRLFSPLIQIQVKNQKHS
FRLEVKSSESIKTIKDIIAHKLGKDNSSCISLTFQAKHYFEDFETLEDIRVTNGDTILFQ
ETSESKCNIVSTINLDFDQNHFSLLFNLLNIQSIAQDVWDLLMLLPANRQILLDIQNISP
VAEGEASNIIKNWDSLFDPNSSYRLLYSLLIIEALIVPSSFDQIQNNIPNQWKHDFISQG
GAAHLIKILMTSDLQNVSRGNKRNICLSVLLRIIYNILEIDNFSAESIQKYVNPNELLHR
LIALTWNQVEPTIHEENLSTHETEDAMVVSHLIGLIVAILRNSEALFDSFTQNKDILNWI
SLICLLSKDTFIRDKATNGINEICKSINPSKTKPYFLEQFLKLLYTTIEQDRRSSSCQQF
FEVLCSLLQDTCSQEGSDRFSDLLGTLIQMIKTQPIVESTAIYQSDVLLMGLLNLVKILI
ENNNDFKLMAGQEGGLVKEIFHECLFNIATAENHGPTCPPKCKTRDSRDVCFAVLLELAK
GCPENLKEITTLLMDHHKPEEKRSLWSYYPAGNEKSTCGYVGLKNLGATCYINSLMQQLF
MIPGFRYNIIQSEEKSLTPQDQQESLLYQLKIIFANLQESEKKSHDPKDFCLAYKYDGQP
INTSIQMDADEFFNMLFDKLENQLKGSTQEKLLQDFFGGSSVNQFISQECNHVSEREEPF
YTISVEVKNKKEIQESLQLFVESETLDGDNKYFCSNCSQKVKALMRRCIKNLPNTLIIHN
KRFEFDLDLMKRTKLNDALRFPMTIDMEPYTKEYLERKEAVEKAKEKGEPIPEYAPLHPP
QYYQYELAGILVHTGTADSGHYYSYIKEREPLNDGEPRRWILFNDQATEVFNPEEISKAC
FGGYDQMEQGKSNFRSGPRVNNAYMLFYERSFISGELTKKYETISPSNASKLVPKDMFSS
VWKKNMKFLNDKNIFDPNYFQFLLNIIKLEDEGLNRMDFTSSQELLKEKSLDVIDVDEED
KKQQIQAQSRQQLQSSNDSSISFNQQMESIELGTRFLIETLFHAKDKKILQETVNYLISL
YERNIEACYWLLNTIIQDSSWIRQIFLTCVTLDPRESMMKLLLSVIKILQPYEKNNYGLE
EDNSMEEASSEQFINGSGLSTIGGLGNSGASVEIIGSSGDGSSIIATKGKQKASSQMVLD
DEVYPNFSDLRKPKSVIFKFMDCFLEYIKEAPIHWKHFSHYFMFIKEFATLGDEERRYLV
ERNVIGRLIDFFLGDESPIPRHPPHKKTKMGDKYNSPQFTYALEAISILVRSCHTKYSIQ
VPPGEPIYMPEQVSTQLIVMPENDMEILYNPLFFSKAIKDQLLMNSIKEIISYICFNDID
TTRSIINHLESLDANRMSLEVLLPLISLDDIYKDDRVDLAIIPYINILEENFKSRATLSF
LKILVEHAIQYPFVSQWFERNLDRWASSWLIGNEHPEVRLDAYSLLIHITGIQMQTPKPD
VIHNIFFYFLSIDTLKYAKKIAKREKDHRGIFRFELYFKFLRNCITALPECKKNFTISAT
QFYSLMNEIIFQQNEIDRNRQELTHFVVDVIRDNQENIQLLLKEQFTHKLMDYFISISSR
EDLKQFNQKSLPSFYEILYVLSKESKPFLEYVLGHLNFQWACKFLLCECGDYNDIATYLF
KLLELIPSVPKCASSLLEGFLQFPNFFYYPSHSLQVVKLLILSKKEAVCFINNGGVHIFS
KFLSNTKDLTDQLNYLPKTVDLLYFILTTIRQQPQQTQPQPQIDSSDAAGEDSIESSSSS
QSGLSIPMQDLTSDIKYLQTILFAIIETNKTLFEKTSKFLNFISSESPETTISSFGEYLL
KWTSKKTNYFILQQQQQQQQQQQQQQQQQQQQQNINSINLVDDPRQQSYGYPQQSQQPRP
TFINDFGLSEQFLKGLVEIVLIALQNSPNNDSKGSINLAKFIKEIFSFNQELASPLLITS
FTYLKLEEKRSLVEFCIHNNIICSEINTNSSVIDNLYNFIKSFLQEKSNEEIVNHLCTEL
EEKVTTAIVSIQSLESFTIDKEIDTHLFVLNNALRQIELYSCSSNDKSRQSLNSTMSALK
QFAEDVCGKIQSEKAKLFLTNFENLSLSNTN
Download sequence
Identical sequences F0ZN87
jgi|Dicpu1|98163|estExt_fgeneshDP_pg.C_1510018 XP_003288873.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]