SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45442675|ref|NP_994214.1| from Yersinia pestis biovar Microtus str. 91001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45442675|ref|NP_994214.1|
Domain Number 1 Region: 11-372
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.64e-112
Family FMN-linked oxidoreductases 0.000000000359
Further Details:      
 
Domain Number 2 Region: 343-528
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 4.83e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000287
Further Details:      
 
Domain Number 3 Region: 470-528,566-660
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.39e-22
Family C-terminal domain of adrenodoxin reductase-like 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|45442675|ref|NP_994214.1|
Sequence length 682
Comment 2,4-dienoyl-CoA reductase [Yersinia pestis biovar Microtus str. 91001]
Sequence
MVVCLMETAMLAYPHLFTPLDLGFTTLKNRILMGSMHTGLEELPDGPQRLAAFYAERAAG
GVGLIVTGGIAPNMKGGVYQGASVLNDAAQIPHHQVVTEAVHQAGGKIALQILHAGRYSY
QKHPVAPSALQAPINPFVPQALSHEEILQTIADFAHCAQLAKQAGYDGVEIMGSEGYLIN
QFLTARTNQRDDEWGGDFTHRMRFAVEIVRAVRQATGHDFILIYRLSMLDLVEEGSNWVE
IEQLAQAVEQAGATVINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKVNIPLITTNRI
NDPAVAEQVLADGCADMVSMARPFLADAAFVQKAAQGRADEINTCIGCNQACLDQIFDGK
LTSCLVNPRACRETEMPELPTDAPKRLAVVGAGPAGLAFAVTAARRGHQVTLFDAAAEIG
GQFNIAKQIPGKEEFYETLRYFRRQLVLNGVTLQLNTLVQVKQLAEFDEVILACGIQPRL
PCINGIDHPKVLTYLDVLRDKKPVGQRVAIIGAGGIGFDTAEYLSQSGDSPRFDSTAFST
EWGIDQDLAHRGGLSPAGAKVPPSPRQIFLLQRKASKVGEGLGKTTGWIHRTSLAMRGVK
MLNSVSYEAIDDKGLHIIRAEQACCLPVDTIIICAGQEPRRELHQPLLDMGKTVYLIGGA
DKAVELDARRAIDQGTRLALAI
Download sequence
Identical sequences Q8CZR4
gi|22127463|ref|NP_670886.1| 187410.y3589 229193.YP_2909 gi|45442675|ref|NP_994214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]