SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45441475|ref|NP_993014.1| from Yersinia pestis biovar Microtus str. 91001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45441475|ref|NP_993014.1|
Domain Number 1 Region: 17-143
Classification Level Classification E-value
Superfamily PapD-like 2.12e-38
Family Pilus chaperone 0.00033
Further Details:      
 
Domain Number 2 Region: 137-237
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.0000000000000811
Family Periplasmic chaperone C-domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|45441475|ref|NP_993014.1|
Sequence length 246
Comment pili assembly chaperone [Yersinia pestis biovar Microtus str. 91001]
Sequence
MRLLSLFLLLFTISYDALAGLIAGSTRIIYQPELRERTLMLANTNDYPVVVQTWIDNGDV
DSTPDQAKAPFMVLPAVFKMQAGSVQALRIINKGENLPSDRESVYWLNLYEIPPRERSNI
DVHAQVAMAMNTQMKIFYRPNGLAPPPIDAMGKIKFSLKNIDNQYVIIANNPTPYFVSFG
QIQLQSQQKNYLIAQSMDMMTGPFSTRPYYFEQPPTSLKGKFTVSYIYFDDAGNQVKNSQ
SVTVTL
Download sequence
Identical sequences A0A0E1NVX9 A0A0H3B4D8 A0A0U1EQ53 A0A0U1QXQ2 A0A1U8QTK8 A0A208SA85 A0A2A7VFL3 Q66B63 Q9Z394
gi|153948481|ref|YP_001401140.1| gi|384122276|ref|YP_005504896.1| gi|218929034|ref|YP_002346909.1| gi|51596243|ref|YP_070434.1| gi|186895277|ref|YP_001872389.1| gi|45441475|ref|NP_993014.1| 187410.y2392 214092.YPO1918 229193.YP_1661 273123.YPTB1917 349747.YpsIP31758_2167 360102.YPA_1296 502800.YPK_2276 502801.YPTS_1966 gi|22126276|ref|NP_669699.1| WP_002227954.1.100083 WP_002227954.1.10105 WP_002227954.1.101305 WP_002227954.1.101382 WP_002227954.1.101928 WP_002227954.1.10736 WP_002227954.1.10935 WP_002227954.1.11693 WP_002227954.1.12167 WP_002227954.1.12463 WP_002227954.1.12736 WP_002227954.1.12857 WP_002227954.1.14063 WP_002227954.1.14169 WP_002227954.1.14804 WP_002227954.1.15321 WP_002227954.1.15555 WP_002227954.1.15605 WP_002227954.1.17135 WP_002227954.1.17141 WP_002227954.1.17873 WP_002227954.1.17983 WP_002227954.1.18208 WP_002227954.1.18640 WP_002227954.1.19329 WP_002227954.1.19739 WP_002227954.1.19763 WP_002227954.1.20380 WP_002227954.1.20547 WP_002227954.1.20932 WP_002227954.1.21784 WP_002227954.1.21879 WP_002227954.1.22530 WP_002227954.1.23271 WP_002227954.1.23811 WP_002227954.1.2451 WP_002227954.1.25394 WP_002227954.1.26383 WP_002227954.1.2640 WP_002227954.1.26960 WP_002227954.1.27124 WP_002227954.1.27251 WP_002227954.1.2726 WP_002227954.1.28922 WP_002227954.1.29157 WP_002227954.1.29355 WP_002227954.1.2947 WP_002227954.1.2964 WP_002227954.1.30931 WP_002227954.1.311 WP_002227954.1.31496 WP_002227954.1.31739 WP_002227954.1.32343 WP_002227954.1.32388 WP_002227954.1.32736 WP_002227954.1.33203 WP_002227954.1.33324 WP_002227954.1.33937 WP_002227954.1.34031 WP_002227954.1.34138 WP_002227954.1.35389 WP_002227954.1.35538 WP_002227954.1.36088 WP_002227954.1.37174 WP_002227954.1.37863 WP_002227954.1.38147 WP_002227954.1.38235 WP_002227954.1.39346 WP_002227954.1.39858 WP_002227954.1.40071 WP_002227954.1.40134 WP_002227954.1.40534 WP_002227954.1.41196 WP_002227954.1.41984 WP_002227954.1.42361 WP_002227954.1.42490 WP_002227954.1.42976 WP_002227954.1.44603 WP_002227954.1.44832 WP_002227954.1.45198 WP_002227954.1.45214 WP_002227954.1.46545 WP_002227954.1.46686 WP_002227954.1.46697 WP_002227954.1.4678 WP_002227954.1.46891 WP_002227954.1.47387 WP_002227954.1.47440 WP_002227954.1.47769 WP_002227954.1.48166 WP_002227954.1.49315 WP_002227954.1.49906 WP_002227954.1.4997 WP_002227954.1.50093 WP_002227954.1.50185 WP_002227954.1.51284 WP_002227954.1.51293 WP_002227954.1.51772 WP_002227954.1.51934 WP_002227954.1.52158 WP_002227954.1.52247 WP_002227954.1.52473 WP_002227954.1.52734 WP_002227954.1.52792 WP_002227954.1.52819 WP_002227954.1.53300 WP_002227954.1.53838 WP_002227954.1.53883 WP_002227954.1.53953 WP_002227954.1.54568 WP_002227954.1.54951 WP_002227954.1.55194 WP_002227954.1.5592 WP_002227954.1.56031 WP_002227954.1.56912 WP_002227954.1.57585 WP_002227954.1.57657 WP_002227954.1.58067 WP_002227954.1.58543 WP_002227954.1.59102 WP_002227954.1.59431 WP_002227954.1.5957 WP_002227954.1.59687 WP_002227954.1.59789 WP_002227954.1.59885 WP_002227954.1.60437 WP_002227954.1.62232 WP_002227954.1.62342 WP_002227954.1.6333 WP_002227954.1.63387 WP_002227954.1.63641 WP_002227954.1.64142 WP_002227954.1.64474 WP_002227954.1.64780 WP_002227954.1.64786 WP_002227954.1.64910 WP_002227954.1.653 WP_002227954.1.65400 WP_002227954.1.65554 WP_002227954.1.65706 WP_002227954.1.65718 WP_002227954.1.6581 WP_002227954.1.66546 WP_002227954.1.66616 WP_002227954.1.67404 WP_002227954.1.67850 WP_002227954.1.6791 WP_002227954.1.68361 WP_002227954.1.70171 WP_002227954.1.70319 WP_002227954.1.70377 WP_002227954.1.70726 WP_002227954.1.7083 WP_002227954.1.7169 WP_002227954.1.71744 WP_002227954.1.72280 WP_002227954.1.72440 WP_002227954.1.7402 WP_002227954.1.74131 WP_002227954.1.74310 WP_002227954.1.74738 WP_002227954.1.7518 WP_002227954.1.75208 WP_002227954.1.75337 WP_002227954.1.75689 WP_002227954.1.76670 WP_002227954.1.77387 WP_002227954.1.77429 WP_002227954.1.77691 WP_002227954.1.7841 WP_002227954.1.78556 WP_002227954.1.79515 WP_002227954.1.79981 WP_002227954.1.80331 WP_002227954.1.81848 WP_002227954.1.81877 WP_002227954.1.8210 WP_002227954.1.82151 WP_002227954.1.82619 WP_002227954.1.83039 WP_002227954.1.83265 WP_002227954.1.83630 WP_002227954.1.8420 WP_002227954.1.84720 WP_002227954.1.85270 WP_002227954.1.8559 WP_002227954.1.85802 WP_002227954.1.86034 WP_002227954.1.86413 WP_002227954.1.87107 WP_002227954.1.8728 WP_002227954.1.87418 WP_002227954.1.87853 WP_002227954.1.87988 WP_002227954.1.89359 WP_002227954.1.8964 WP_002227954.1.9051 WP_002227954.1.91373 WP_002227954.1.91844 WP_002227954.1.92604 WP_002227954.1.927 WP_002227954.1.9320 WP_002227954.1.93928 WP_002227954.1.94201 WP_002227954.1.94545 WP_002227954.1.94683 WP_002227954.1.95746 WP_002227954.1.95981 WP_002227954.1.97375 WP_002227954.1.97448 WP_002227954.1.97791 WP_002227954.1.97864 WP_002227954.1.97872 WP_002227954.1.97894 WP_002227954.1.99416 WP_002227954.1.99882 WP_002227954.1.99990 YP_002346909.1.25044 gi|108807292|ref|YP_651208.1| gi|170024501|ref|YP_001721006.1| gi|384126324|ref|YP_005508938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]