SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45441478|ref|NP_993017.1| from Yersinia pestis biovar Microtus str. 91001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45441478|ref|NP_993017.1|
Domain Number 1 Region: 21-133
Classification Level Classification E-value
Superfamily PapD-like 4.45e-32
Family Pilus chaperone 0.0011
Further Details:      
 
Domain Number 2 Region: 137-211
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.000000000000314
Family Periplasmic chaperone C-domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|45441478|ref|NP_993017.1|
Sequence length 214
Comment pili assembly chaperone [Yersinia pestis biovar Microtus str. 91001]
Sequence
MILIARQIIACSMLLLTSVSLSVQASVVMTGTRIIYPEGSREKVLQLSNKDDHPNLVQLW
MDDGNNQSSPSKSDVPFALTPQIFRMEANSGQVVRLTYIARNLPKNRESVFYLNFLQIPA
LKADTLGEKISVTLDTTTGNKIKVHNPTGYYISLRDAKIVSNGKTVSFATSEMFAPDSTT
DLALPIGIKAKKGELLILNVVNDYGATIPNNYYL
Download sequence
Identical sequences A0A0M1V1W4 A0A1U8QZ55 A0A208SAB8 Q9ZC31
187410.y2389 214092.YPO1921 229193.YP_1664 349746.YpAngola_A2109 386656.YPDSF_1202 gi|145598495|ref|YP_001162571.1| gi|384126321|ref|YP_005508935.1| gi|384122280|ref|YP_005504900.1| gi|45441478|ref|NP_993017.1| NYSGRC-SEC-16122169 gi|218929037|ref|YP_002346912.1| WP_002212747.1.100083 WP_002212747.1.10105 WP_002212747.1.101305 WP_002212747.1.101382 WP_002212747.1.101928 WP_002212747.1.10736 WP_002212747.1.10935 WP_002212747.1.11693 WP_002212747.1.12463 WP_002212747.1.12736 WP_002212747.1.1388 WP_002212747.1.14063 WP_002212747.1.14804 WP_002212747.1.15321 WP_002212747.1.15555 WP_002212747.1.15605 WP_002212747.1.15689 WP_002212747.1.16243 WP_002212747.1.17135 WP_002212747.1.17141 WP_002212747.1.17608 WP_002212747.1.17873 WP_002212747.1.17983 WP_002212747.1.18208 WP_002212747.1.18640 WP_002212747.1.18826 WP_002212747.1.19329 WP_002212747.1.19425 WP_002212747.1.19739 WP_002212747.1.19763 WP_002212747.1.20035 WP_002212747.1.21486 WP_002212747.1.21784 WP_002212747.1.21879 WP_002212747.1.22530 WP_002212747.1.23271 WP_002212747.1.23687 WP_002212747.1.23811 WP_002212747.1.2451 WP_002212747.1.25181 WP_002212747.1.25394 WP_002212747.1.2640 WP_002212747.1.26960 WP_002212747.1.27124 WP_002212747.1.27251 WP_002212747.1.2726 WP_002212747.1.28922 WP_002212747.1.29157 WP_002212747.1.29355 WP_002212747.1.2947 WP_002212747.1.29622 WP_002212747.1.2964 WP_002212747.1.29685 WP_002212747.1.29814 WP_002212747.1.3092 WP_002212747.1.30931 WP_002212747.1.311 WP_002212747.1.31336 WP_002212747.1.31496 WP_002212747.1.31739 WP_002212747.1.32343 WP_002212747.1.32388 WP_002212747.1.33203 WP_002212747.1.33661 WP_002212747.1.33937 WP_002212747.1.34031 WP_002212747.1.34138 WP_002212747.1.35389 WP_002212747.1.35538 WP_002212747.1.36088 WP_002212747.1.37174 WP_002212747.1.37494 WP_002212747.1.37863 WP_002212747.1.38147 WP_002212747.1.38235 WP_002212747.1.38743 WP_002212747.1.38824 WP_002212747.1.38993 WP_002212747.1.39346 WP_002212747.1.3976 WP_002212747.1.40071 WP_002212747.1.40134 WP_002212747.1.40534 WP_002212747.1.41196 WP_002212747.1.4210 WP_002212747.1.42490 WP_002212747.1.44408 WP_002212747.1.44832 WP_002212747.1.45198 WP_002212747.1.45214 WP_002212747.1.46545 WP_002212747.1.46686 WP_002212747.1.46731 WP_002212747.1.4678 WP_002212747.1.46891 WP_002212747.1.47387 WP_002212747.1.47440 WP_002212747.1.48166 WP_002212747.1.49906 WP_002212747.1.4997 WP_002212747.1.50093 WP_002212747.1.51284 WP_002212747.1.51293 WP_002212747.1.51772 WP_002212747.1.51934 WP_002212747.1.52158 WP_002212747.1.52247 WP_002212747.1.52734 WP_002212747.1.52819 WP_002212747.1.52969 WP_002212747.1.53300 WP_002212747.1.53838 WP_002212747.1.53953 WP_002212747.1.54568 WP_002212747.1.54951 WP_002212747.1.55194 WP_002212747.1.5592 WP_002212747.1.56031 WP_002212747.1.56912 WP_002212747.1.57585 WP_002212747.1.57657 WP_002212747.1.58067 WP_002212747.1.59102 WP_002212747.1.59431 WP_002212747.1.5957 WP_002212747.1.59687 WP_002212747.1.59789 WP_002212747.1.59885 WP_002212747.1.60437 WP_002212747.1.60707 WP_002212747.1.60896 WP_002212747.1.61689 WP_002212747.1.62232 WP_002212747.1.62342 WP_002212747.1.6270 WP_002212747.1.63387 WP_002212747.1.64142 WP_002212747.1.64474 WP_002212747.1.64780 WP_002212747.1.64786 WP_002212747.1.64910 WP_002212747.1.653 WP_002212747.1.65400 WP_002212747.1.6570 WP_002212747.1.65706 WP_002212747.1.65718 WP_002212747.1.6581 WP_002212747.1.66546 WP_002212747.1.66616 WP_002212747.1.67404 WP_002212747.1.67850 WP_002212747.1.68361 WP_002212747.1.68753 WP_002212747.1.70117 WP_002212747.1.70171 WP_002212747.1.70319 WP_002212747.1.70377 WP_002212747.1.70417 WP_002212747.1.70726 WP_002212747.1.7083 WP_002212747.1.7169 WP_002212747.1.71744 WP_002212747.1.72280 WP_002212747.1.72440 WP_002212747.1.72486 WP_002212747.1.7402 WP_002212747.1.74131 WP_002212747.1.74310 WP_002212747.1.74738 WP_002212747.1.75407 WP_002212747.1.75636 WP_002212747.1.75689 WP_002212747.1.75821 WP_002212747.1.76670 WP_002212747.1.77387 WP_002212747.1.77429 WP_002212747.1.77691 WP_002212747.1.78004 WP_002212747.1.7841 WP_002212747.1.78556 WP_002212747.1.79515 WP_002212747.1.79550 WP_002212747.1.79981 WP_002212747.1.8009 WP_002212747.1.80331 WP_002212747.1.81848 WP_002212747.1.81877 WP_002212747.1.8210 WP_002212747.1.82133 WP_002212747.1.82151 WP_002212747.1.82619 WP_002212747.1.83039 WP_002212747.1.83265 WP_002212747.1.8420 WP_002212747.1.84720 WP_002212747.1.85270 WP_002212747.1.8559 WP_002212747.1.85802 WP_002212747.1.86034 WP_002212747.1.87107 WP_002212747.1.8728 WP_002212747.1.87418 WP_002212747.1.8762 WP_002212747.1.87853 WP_002212747.1.87988 WP_002212747.1.89359 WP_002212747.1.8964 WP_002212747.1.9051 WP_002212747.1.90624 WP_002212747.1.91373 WP_002212747.1.91844 WP_002212747.1.92030 WP_002212747.1.92604 WP_002212747.1.927 WP_002212747.1.9320 WP_002212747.1.93623 WP_002212747.1.93928 WP_002212747.1.94201 WP_002212747.1.94545 WP_002212747.1.94683 WP_002212747.1.95746 WP_002212747.1.95981 WP_002212747.1.97375 WP_002212747.1.97448 WP_002212747.1.97791 WP_002212747.1.97864 WP_002212747.1.97872 WP_002212747.1.97894 WP_002212747.1.99416 WP_002212747.1.99990 YP_002346912.1.25044 gi|22126273|ref|NP_669696.1| gi|162420776|ref|YP_001606564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]