SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45442772|ref|NP_994311.1| from Yersinia pestis biovar Microtus str. 91001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45442772|ref|NP_994311.1|
Domain Number 1 Region: 24-141
Classification Level Classification E-value
Superfamily PapD-like 3.92e-40
Family Pilus chaperone 0.00000529
Further Details:      
 
Domain Number 2 Region: 148-234
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 3.92e-23
Family Periplasmic chaperone C-domain 0.0000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|45442772|ref|NP_994311.1|
Sequence length 239
Comment fimbrial chaperone protein [Yersinia pestis biovar Microtus str. 91001]
Sequence
MKKLSLIALTSTVVFTSYTANAAIALDRTRIIYNGQDKSISLNISNENKTLPYLAQAWIE
NEQQQKVTTPLVATPPVQRVEAGKKSAVRISATPEALKLPQDRESLFYFNLREIPPRSEK
SNVMQIALQTKIKLFYRPEGITPATGQIWQEQLVLHKTAQGFRLENPTPYYITVVGLAEK
GKSSADSNFQPLMVAPKSSAELKSASFTAPVLTYINDYGGRPELSFSCSGSTCRAAKAI
Download sequence
Identical sequences A0A0E1NR97 A0A0H2W856 A0A0H2YE92 A0A0H3B1I4 A0A0M1V533 A0A208S100 Q665Z7 Q7CGJ5
gi|384416235|ref|YP_005625597.1| gi|170022945|ref|YP_001719450.1| gi|384125078|ref|YP_005507692.1| 187410.y3479 214092.YPO0699 229193.YP_3012 273123.YPTB3362 349746.YpAngola_A0251 360102.YPA_3094 377628.YPN_0556 386656.YPDSF_0482 502800.YPK_0696 gi|22127353|ref|NP_670776.1| gi|45442772|ref|NP_994311.1| gi|162419097|ref|YP_001604871.1| WP_002211457.1.100246 WP_002211457.1.10066 WP_002211457.1.100921 WP_002211457.1.100931 WP_002211457.1.10105 WP_002211457.1.101305 WP_002211457.1.101382 WP_002211457.1.101928 WP_002211457.1.102012 WP_002211457.1.102067 WP_002211457.1.10736 WP_002211457.1.10935 WP_002211457.1.10955 WP_002211457.1.11693 WP_002211457.1.12463 WP_002211457.1.12736 WP_002211457.1.12857 WP_002211457.1.1388 WP_002211457.1.14063 WP_002211457.1.14804 WP_002211457.1.15321 WP_002211457.1.15555 WP_002211457.1.15605 WP_002211457.1.15689 WP_002211457.1.16243 WP_002211457.1.16333 WP_002211457.1.17135 WP_002211457.1.17141 WP_002211457.1.17608 WP_002211457.1.17873 WP_002211457.1.17983 WP_002211457.1.18208 WP_002211457.1.18640 WP_002211457.1.18826 WP_002211457.1.19329 WP_002211457.1.19425 WP_002211457.1.19739 WP_002211457.1.19763 WP_002211457.1.20035 WP_002211457.1.2064 WP_002211457.1.21486 WP_002211457.1.21784 WP_002211457.1.21879 WP_002211457.1.21934 WP_002211457.1.22530 WP_002211457.1.22542 WP_002211457.1.22708 WP_002211457.1.23157 WP_002211457.1.23271 WP_002211457.1.23687 WP_002211457.1.23811 WP_002211457.1.24002 WP_002211457.1.2451 WP_002211457.1.24517 WP_002211457.1.25181 WP_002211457.1.25394 WP_002211457.1.26383 WP_002211457.1.2640 WP_002211457.1.26960 WP_002211457.1.27124 WP_002211457.1.27251 WP_002211457.1.2726 WP_002211457.1.28647 WP_002211457.1.28922 WP_002211457.1.29157 WP_002211457.1.29355 WP_002211457.1.2947 WP_002211457.1.29622 WP_002211457.1.2964 WP_002211457.1.29685 WP_002211457.1.29814 WP_002211457.1.3092 WP_002211457.1.30931 WP_002211457.1.311 WP_002211457.1.31336 WP_002211457.1.31496 WP_002211457.1.31739 WP_002211457.1.31805 WP_002211457.1.32343 WP_002211457.1.32388 WP_002211457.1.32446 WP_002211457.1.33203 WP_002211457.1.33661 WP_002211457.1.33937 WP_002211457.1.34031 WP_002211457.1.34138 WP_002211457.1.35389 WP_002211457.1.35538 WP_002211457.1.36088 WP_002211457.1.37174 WP_002211457.1.37494 WP_002211457.1.37863 WP_002211457.1.38147 WP_002211457.1.38235 WP_002211457.1.38532 WP_002211457.1.38743 WP_002211457.1.38824 WP_002211457.1.38993 WP_002211457.1.39066 WP_002211457.1.39346 WP_002211457.1.3976 WP_002211457.1.40071 WP_002211457.1.40134 WP_002211457.1.40534 WP_002211457.1.40853 WP_002211457.1.41196 WP_002211457.1.4210 WP_002211457.1.42490 WP_002211457.1.44408 WP_002211457.1.44598 WP_002211457.1.44603 WP_002211457.1.44832 WP_002211457.1.45198 WP_002211457.1.45214 WP_002211457.1.46262 WP_002211457.1.46545 WP_002211457.1.46686 WP_002211457.1.46731 WP_002211457.1.4678 WP_002211457.1.46891 WP_002211457.1.47387 WP_002211457.1.47440 WP_002211457.1.47881 WP_002211457.1.48166 WP_002211457.1.48722 WP_002211457.1.4889 WP_002211457.1.49906 WP_002211457.1.4997 WP_002211457.1.50010 WP_002211457.1.50093 WP_002211457.1.50106 WP_002211457.1.50185 WP_002211457.1.50984 WP_002211457.1.51284 WP_002211457.1.51293 WP_002211457.1.51588 WP_002211457.1.51772 WP_002211457.1.51934 WP_002211457.1.52158 WP_002211457.1.52247 WP_002211457.1.52734 WP_002211457.1.52792 WP_002211457.1.52819 WP_002211457.1.52969 WP_002211457.1.53147 WP_002211457.1.53300 WP_002211457.1.53838 WP_002211457.1.53848 WP_002211457.1.53883 WP_002211457.1.53953 WP_002211457.1.54568 WP_002211457.1.54951 WP_002211457.1.55194 WP_002211457.1.55695 WP_002211457.1.5592 WP_002211457.1.56031 WP_002211457.1.56912 WP_002211457.1.56953 WP_002211457.1.57585 WP_002211457.1.57657 WP_002211457.1.58067 WP_002211457.1.58794 WP_002211457.1.59102 WP_002211457.1.59431 WP_002211457.1.5957 WP_002211457.1.59635 WP_002211457.1.59687 WP_002211457.1.59789 WP_002211457.1.59885 WP_002211457.1.60437 WP_002211457.1.60707 WP_002211457.1.60896 WP_002211457.1.61689 WP_002211457.1.62232 WP_002211457.1.62342 WP_002211457.1.6270 WP_002211457.1.63387 WP_002211457.1.64142 WP_002211457.1.64474 WP_002211457.1.64780 WP_002211457.1.64786 WP_002211457.1.64910 WP_002211457.1.653 WP_002211457.1.65400 WP_002211457.1.65554 WP_002211457.1.6570 WP_002211457.1.65706 WP_002211457.1.65718 WP_002211457.1.6581 WP_002211457.1.66118 WP_002211457.1.66546 WP_002211457.1.66616 WP_002211457.1.67404 WP_002211457.1.67850 WP_002211457.1.6791 WP_002211457.1.68361 WP_002211457.1.68371 WP_002211457.1.68753 WP_002211457.1.68855 WP_002211457.1.69018 WP_002211457.1.69316 WP_002211457.1.69951 WP_002211457.1.70117 WP_002211457.1.70171 WP_002211457.1.70319 WP_002211457.1.70377 WP_002211457.1.70417 WP_002211457.1.70726 WP_002211457.1.7083 WP_002211457.1.7169 WP_002211457.1.71744 WP_002211457.1.72280 WP_002211457.1.72440 WP_002211457.1.72486 WP_002211457.1.7402 WP_002211457.1.74131 WP_002211457.1.74310 WP_002211457.1.74577 WP_002211457.1.74738 WP_002211457.1.75173 WP_002211457.1.7518 WP_002211457.1.75407 WP_002211457.1.75636 WP_002211457.1.75821 WP_002211457.1.76555 WP_002211457.1.76670 WP_002211457.1.77387 WP_002211457.1.77429 WP_002211457.1.77691 WP_002211457.1.78004 WP_002211457.1.7841 WP_002211457.1.78556 WP_002211457.1.79515 WP_002211457.1.79550 WP_002211457.1.79609 WP_002211457.1.79981 WP_002211457.1.8009 WP_002211457.1.80331 WP_002211457.1.81848 WP_002211457.1.81877 WP_002211457.1.8210 WP_002211457.1.82133 WP_002211457.1.82151 WP_002211457.1.82270 WP_002211457.1.82436 WP_002211457.1.82619 WP_002211457.1.8303 WP_002211457.1.83265 WP_002211457.1.8420 WP_002211457.1.84703 WP_002211457.1.84720 WP_002211457.1.85269 WP_002211457.1.85270 WP_002211457.1.8559 WP_002211457.1.85802 WP_002211457.1.86034 WP_002211457.1.86059 WP_002211457.1.86413 WP_002211457.1.87107 WP_002211457.1.8728 WP_002211457.1.87418 WP_002211457.1.8762 WP_002211457.1.87853 WP_002211457.1.87988 WP_002211457.1.88362 WP_002211457.1.88472 WP_002211457.1.89359 WP_002211457.1.8964 WP_002211457.1.90176 WP_002211457.1.9051 WP_002211457.1.90624 WP_002211457.1.91373 WP_002211457.1.91844 WP_002211457.1.92030 WP_002211457.1.92331 WP_002211457.1.92604 WP_002211457.1.927 WP_002211457.1.9311 WP_002211457.1.9320 WP_002211457.1.93623 WP_002211457.1.93928 WP_002211457.1.93933 WP_002211457.1.94052 WP_002211457.1.94201 WP_002211457.1.94545 WP_002211457.1.94683 WP_002211457.1.95746 WP_002211457.1.95981 WP_002211457.1.97245 WP_002211457.1.97375 WP_002211457.1.97448 WP_002211457.1.97791 WP_002211457.1.97864 WP_002211457.1.97872 WP_002211457.1.97894 WP_002211457.1.99109 WP_002211457.1.99383 WP_002211457.1.9941 WP_002211457.1.99416 WP_002211457.1.99788 WP_002211457.1.99882 WP_002211457.1.99990 YP_002345763.1.25044 gi|108810721|ref|YP_646488.1| gi|51597661|ref|YP_071852.1| gi|294502765|ref|YP_003566827.1| gi|145597792|ref|YP_001161868.1| gi|384121201|ref|YP_005503821.1| gi|218927888|ref|YP_002345763.1| gi|384137309|ref|YP_005520011.1| gi|108809085|ref|YP_653001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]