SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma01g25270.3|PACid:16244440 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma01g25270.3|PACid:16244440
Domain Number 1 Region: 66-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.12e-38
Family B3 DNA binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma01g25270.3|PACid:16244440
Sequence length 408
Sequence
MEQLEASTNQELNQRIPLLKLPTKILCRVVNVHLLAEQETDEVYAQITLVPESSQDEPTN
ADPCTAEPPRAPVHSFSKVLTASDTSTHGGFSVLRKHATECLPVLDMSQPTPTQELVAKD
LHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFLRGDNGELRVGVRRLARQ
ASSMPSSVISSQSMHLGVLATASHAVATQTLFVVYYKPRTSQFIIGVNKYLEAMDKKFSV
GMRFKMRFEGDDSAETDKRFSGTIVGVEDISPHWVNSKWRSLKVQWDEPAAVPRPDRVSP
WEIEPFVASASTPSVQPTMVKTKRPRPPSETPDVDTTSVASVFWDAGLQQADMAQKNVLA
ESKWNDNTGTWHHMQTDMNSKSNSGNTMLRNQTEGSWLSSPHSTSTQE
Download sequence
Identical sequences Glyma01g25270.3|PACid:16244440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]