SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma01g45640.1|PACid:16246437 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma01g45640.1|PACid:16246437
Domain Number 1 Region: 53-150
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.26e-23
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma01g45640.1|PACid:16246437
Sequence length 181
Sequence
KKGRPPIPKKVCRLIVFGLIKRKGEGTGMGIVIDAPPCNTQAYQRAKEVQANLSPQFPTF
LKSMLPSHVAGGFWLGLPKKFCNLYMPKLDTTIALEDETGQLYETKYLAQKAGLSAGWRG
FSIAHNLLEMDVLIFHLVQPSKFRVYIIRSQESDELDGALVLLKSDGCRKQSDVVLIYYG
L
Download sequence
Identical sequences Glyma01g45640.1|PACid:16246437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]