SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma02g01060.1|PACid:16246561 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma02g01060.1|PACid:16246561
Domain Number 1 Region: 81-265,386-433
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.07e-60
Family Tandem AAA-ATPase domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 729-948
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 7.72e-59
Family Helical scaffold and wing domains of SecA 0.0000263
Further Details:      
 
Domain Number 3 Region: 434-543,632-723
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.46e-51
Family Tandem AAA-ATPase domain 0.00000889
Further Details:      
 
Domain Number 4 Region: 264-386
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 2.35e-43
Family Pre-protein crosslinking domain of SecA 0.0000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma02g01060.1|PACid:16246561
Sequence length 987
Sequence
MAASSLCSSFTSKTWNPHARYHHKTLAPPYSAFLRGDLQLHPPSVSGTRRRRRRRSGSVA
SLGGLLGGIFKGADTGEATKQQYAATVNIINGLEPEISALSDSELRDRTFALRERAQHGQ
SLDSLLPEAFAVVREASKRVLGLRPFDVQLIGGMVLHKGEIAEMRTGEGKTLVAVLPAYL
NALSGKGVHVVTVNDYLARRDCEWVGQVPRFLGLKVGLIQQNMTSQQRKENYSCDITYVT
NSELGFDYLRDNLATEITPLIISGPAEKPSDQYYKAAKIAEAFEQDIHYTVDEKQKTVLL
SEQGYEDAEEILAVKDLYDPREQWASYILNAIKAKELFLRDVNYIIRGKEVLIVDEFTGR
VMQGRRWSDGLHQAVEAKEGLPIQNETVTLASISYQNFFLQFPKLCGMTGTAATESTEFE
SIYKLKVTIVPTNKPMIRKDESDVVFRATSGKWRAVVVEISRMHKTGRPVLVGTTSVEQS
DSLSEQLKEAGIPHEVLNAKPENVEREAEIVAQSGRLGAVTIATNMAGRGTDIILGGNAE
FMARLKLREILMPRVVKPSEEGFVSIKKPPPSKTWKVNEKLFPCQLSNKNVDMAEKAVQL
AVETWGKRSLTELEAEERLSYTCEKGPAQDEVIAKLRNAFLEIGKEYKVFTEEERKKVVE
AGGLHVVGTERHESRRIDNQLRGRSGRQGDPGSSRFFLSLEDNIFRIFGGDRIQGLMRAF
RVEDLPIESKMLTKALDEAQRKVENYFFDIRKQLFEYDEVLNSQRDRVYTERRRALESDN
LQSLLIEYAELTMDDILEANIGSDAPKDSWDLEKLTAKIQQYCYLLNTLSPDLLGNTCSD
YEELRNYLRLRGREAYLQKRDIVEQQAAGLMKEAERFLILSNIDRLWKEHLQALKFVQQA
VGLRGYAQRDPLIEYKLEGYNLFLDMMAQIRRNVIYSVYQFQPVLVKQDQDKTENRKSGK
RNIARTQVNPNSDPVGTVEPSTSSTTS
Download sequence
Identical sequences Glyma02g01060.1|PACid:16246561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]