SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma02g40400.1|PACid:16249676 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma02g40400.1|PACid:16249676
Domain Number 1 Region: 76-170
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1e-22
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma02g40400.1|PACid:16249676
Sequence length 348
Sequence
MIKRDTEHPKFVVDSVYFFLSQVNIDLPPLRKRSRSSSSSWGSYIARPLDEIKEATKEER
LCALEAAEAIQINLNSSNPSFIKSMVRSHVYSCFWLGLPSKFCEEHLPKTLHDMVLEDEN
GSEYEAVYIGNRAGLSGGWRAFALDHKLDDGDALVFELIEASRFKIYIVRAFPDSVEEKG
NNILEEEGNVRATKAPKAACNLESECKTKKPKQAAVYETKESESSQEYLLDSSIDNEVKP
QGVNPTNKETKFSQKNTPKKSKYPATADSKGKVQIKTEKPKASIKLSNNTRKSKEGINEI
GGSDKLEKNEFVQDADSKLEKVELVEEARKCVTKKLEKTSSKFFRKKA
Download sequence
Identical sequences Glyma02g40400.1|PACid:16249676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]