SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma03g36710.1|PACid:16253571 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma03g36710.1|PACid:16253571
Domain Number 1 Region: 36-173
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.27e-36
Family B3 DNA binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 457-529
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000922
Family PB1 domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma03g36710.1|PACid:16253571
Sequence length 549
Sequence
MNVELKAEAYSDEVYAQVTLVPEVQKDNLCFEEEVNIDQIPSRNAAYSFSKILTPSDTST
HGGFSVPKKYADECFPPLDMTLQTPAQEIVAKDLNGFEWRFRHIYRGQPKRHLLTSGWSL
FVNAKKLVAGDSCIFVRGESGELRVGIRRAAENLSNISQSSSLISGHSMQLGILTNASNA
VGNRTMFLVYYRPWTNPFEFIVHLQTYLKSTLQDYPIGTRVQMQHEVEESLRRLAGTIIG
NEDIDSIRWPGSAWRRLKVQWDAIVEDKMHPERVCPWWIEPLESAKEKKQVPALPTKKKG
HALLNQRSLPGISGFGKNDVHQNSAGPSSQTRRADGDLQGQDYSGLSPPQPLQRAPSTDI
IRPSKVPIRGSRFGKENRNQHPFLKQDPLHKSLGRSMSLTHEDLSITSSNLTSIGSESLG
MPSTESRDENDAPFGQPGSSRKTCKKCRCVNNRSCTKVLKLGNALGRAVDLARFNGYTEL
IAELDSMFDFQGTLISGGSGWHVTCLDDEGDMMQLGDYPWQDFLGVVQKMIICPKEGTDN
LKPGSSANP
Download sequence
Identical sequences Glyma03g36710.1|PACid:16253571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]