SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma03g41920.1|PACid:16254194 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma03g41920.1|PACid:16254194
Domain Number 1 Region: 105-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.76e-40
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 469-554
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000032
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma03g41920.1|PACid:16254194
Sequence length 582
Sequence
MAGVGDGDLYTQLWKLCAGPLVDVPRQGERVFYFPQGHMEQLQASTNQGLNQEIPHFNLP
PKILCRVVHIQLLAEQETDEVYARITLLPESNQEEPTSPDPSPPETQKQVFHTFSKILTA
SDTSTHGGFSVLRRHATECLPQLDMTQTTPSQELVAEDLHGFEWKFKHIFRGQPRRHLLT
TGWSTFVTSKKLVAGDAFVFLRGENGELRVGVRRVARQQSPMPSSVISSQSMHLGVLATA
SHAFLTSTMFVVYYKPRTSQFIIGVNKYLEAENNKFSVGMRFKMRFEVEDSPERRFSGTI
VGVGDVSPGWWNSQWRSLKVQWDEPAIIPRPERVSSWEIEPFAASTALNVTQQLVAVQRS
KAMKIQLYAVPAQSTVSSRPKDDLAHDPMECAKRSSQNPMNCWIFGVNLTNNITKNVTLP
DKEQLGCPAIIPSGPKDSIPVAACETEAGQNPYYSLSNKEHKQNISDGSPSASQRHTRTR
TKVQMQGIAVGRAVDLTVLKDYDDLIDELEKMFDIKGELQMQTKWAITFTDDGNDMMLVG
DDPWPEFCTVVKRIFICSREDVKKMKSKHSSSSSVVPSAQTT
Download sequence
Identical sequences Glyma03g41920.1|PACid:16254194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]