SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma04g16680.1|PACid:16256057 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma04g16680.1|PACid:16256057
Domain Number 1 Region: 77-172
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000687
Family B3 DNA binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma04g16680.1|PACid:16256057
Sequence length 186
Sequence
MTQEKDLYKWHGNLFGGQNCKQPQGSSSSSIPTMEEDIDKAAEALVSLVTSYQEGKHNLP
PHENLRDYILEYGEPLKKVLTNTDVNVNQNRIFLKKEHVEKSFLPLLRNDENIEEGIRVC
AYDMHDNSYTLMFKKWTKKFYVLNGEWKKFFQIHELQKNDVVTVWIFRHSKSNKVCFALA
YQKIER
Download sequence
Identical sequences I1JW23
XP_006579165.2.40590 Glyma04g16680.1|PACid:16256057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]