SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma04g23550.1|PACid:16256268 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma04g23550.1|PACid:16256268
Domain Number 1 Region: 130-215
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 1.7e-23
Family Translation initiation factor IF3, C-terminal domain 0.00048
Further Details:      
 
Domain Number 2 Region: 57-123
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 1.44e-20
Family Translation initiation factor IF3, N-terminal domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma04g23550.1|PACid:16256268
Sequence length 243
Sequence
MSAVGGFTLTLSPINLKLPLLPSNRLFNRTPFKSSISFSLRSNDEQQPLGLDIAALRSAS
VRLIDGNQIMVGVVSKTLARQMAQDSELDLVIVSPDADPPVVRMMDYNKYKYEQQKKKKG
QQKRSAANRMDLKELKMGYNIDQHDYSVRLKAAQKFLKDGDKVKVIVNLKGRETEFRNIA
IELIKRFQSDVGELATEETKSFRDRNMSIVMVPKKAALQKAQEPPKRKDMSAADEVSAGV
QHN
Download sequence
Identical sequences C6SX90
NP_001236679.1.40590 Glyma04g23550.1|PACid:16256268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]