SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma04g37760.1|PACid:16257086 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma04g37760.1|PACid:16257086
Domain Number 1 Region: 138-271
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.89e-40
Family B3 DNA binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 716-790
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000054
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma04g37760.1|PACid:16257086
Sequence length 843
Sequence
MTSLEVTMKGNCLNHNDGGATEPHSPSTAKDAEAALFRELWHACAGPLVTVPRERERVFY
FPQGHIEQVEASTNQVADQHMPVYDLPPKILCRVINVQLKAEPDTDEVFAQVTLLPEPNQ
DENAVEKEPPPPPPPRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSKQPPTQ
ELVAKDLHANEWRFKHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGV
RRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTIFTVYYKPRTSPAEFIVPYDQYME
SLKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDSDPKRWRDSKWRCLKVRWDETSNTP
RPERVSPWKIEPALAPPALNPLSMPRPKRPRSNAVPSSPDSSVLTREASSKVSIDPSPAN
GFPRVLQGQEFSTLRGNFAESNESDTAEKSVVWPPAAVDDEKMDVSTSRRYGSESWMSMG
RNEPTYSDLLSGFGASGDPSHLSLKDQMSPAYSARKQSLDHEGKLHMPHPWPVMPSSLSL
SILDSNTKGPAHGGDTTYKARGNLRYSAFGEYPALHGHKVEHSHGNLMPPPPALLTQYQS
PCSRELMSKQVSAKTCEAVKPKDGDCKLFGFSLISGPTLPEPSLSQRNVSEAADQMHLTA
HQQRTSENDEKLDHSKGSRPVDDIVVDDQDRPLRTSQLHTKDVQAKPLSGSARSCTKVHK
KGIALGRSVDLTKYSGYDELVAELDQLFEFGGELLSTKKDWLIVFTDNEGDMMLVGDDPW
QEFCAMVRKIYIYPKEEIQKMSPGTLSSKNEENHSVTASEGADTKDVKCQPHQKFNSENG
LDA
Download sequence
Identical sequences I1JXQ2
Glyma04g37760.1|PACid:16257086 XP_003523174.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]