SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma05g27580.1|PACid:16259834 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma05g27580.1|PACid:16259834
Domain Number 1 Region: 112-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.05e-48
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 2 Region: 711-791
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000144
Family PB1 domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma05g27580.1|PACid:16259834
Sequence length 848
Sequence
MKLSSSGFSSPPQEGEKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTNRE
VDGHIPNYPSLPPQLICQLHNVTMHADTETDEVYAQMTLQPLNPQEQKEAYLPAELGTPS
KQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPCQELIARDLHGNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQPVMPSSVL
SSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPFAKYVKAVYHTRVSVGMRFRM
LFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
TFPMYPSPFPLRLKRPWPPGLPSFHDMYQAMAAAALQDMWTSDPSKQHPTSAIQFQQQQN
FPNRTSALMQTQMLQHQENSHPSPSPSQSQAQTQTHFQQHLQHQHSFNTQNQHNLLQQQQ
QSQLQQQQVVDHQQISSAVSTMSQFVSAPQSQSPPMQAISSLGHQQSFSDSNGNPVTTAV
VSPLHSILGSFPQDDTSHLLNLPRSTSWVPVQHSTAWPSSKRVAVDPLFSSGASQCVLPQ
VEQLGQPQSTMAQNGIALPPFPGRECTIEGSNDPQNHLLFGVNIEPSSLLMHNGMSSLKG
VSSNSDSPTIPFQSSNYLNTTVPDSSLNPGMTHNIGESGFLQTPENGGQGNPTNKTFVKV
YKSGSFGRSLDITKFTSYPELRSELARMFGLEGELEDPVRSGWQLVFVDQENDVLLLGDG
PWPEFVNSVGCIKILSPQEVQQMGNNGLELLNSVPIQRLSNGVCDDYAGREDPRNLSTGI
TIVGSLNY
Download sequence
Identical sequences Glyma05g27580.1|PACid:16259834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]