SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma05g38540.1|PACid:16261168 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma05g38540.1|PACid:16261168
Domain Number 1 Region: 156-289
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-40
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 736-811
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000128
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma05g38540.1|PACid:16261168
Sequence length 858
Sequence
MATSEVSIKGNSVNGKGDNSSGGYTNDVRNGSGGGEARNSSSSSSSARDAEAALYRELWH
ACAGPLVTVPREGERVFYFPQGHIEQVEASTNQVAEQHMPVYDLPPKILCRVINVMLKAE
PDTDEVFAQVTLLPEPNQDENAVEKEGPPAAPPRFHVHSFCKTLTASDTSTHGGFSVLRR
HADECLPPLDMTKQPPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVA
GDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAILTGTMFTVYY
KPRTSPAEFIVPYDQYMESLKNNYTIGMRFKMRFEGEEAPEQRFTGTIVGIEDADTKRWP
KSKWRSLKVRWDETSNIPRPERVSQWKIEPALAPPALNPLPMPRPKRPRSNVVPSSPDSS
VLTREASSKVSVDPLPTSGFQRVLQGQELSTLRGNFAESNESDTVEKSAVWPPVADDEKI
DVSTSRRYGSDSWMSMGRHELTYPDLLSGFGTHGDHSSHPSFVDQNGPVANVGRKHLLDC
EGKHNVLSPWSGVPSSLSLNLLDSNTKGSAQGGDTTYQVRGNLRYSSAFGEYPMLHGHKV
EHSHGNFLMPPPPSTPYESPRSRELLPKPISGKPCEVSKPKDSDCKLFGISLLSSPIAPE
PSVSQRNVPSEPVGHMHTTSHQQRAFDNDQKSEHSRGGSKPADGLLIDDHEKVLQTSQTH
LKDIQAKSHSGSARSCTKVHKKGIALGRSVDLTKFSDYGELIAELDQLFEFGGLLTSPQK
DWLIVYTDNEGDMMLVGDDPWQEFVAMVRKIYIYPKEEIQKMSPGTLSSKNEENQSASEG
ATDTQEIKCQLNNSASDT
Download sequence
Identical sequences A0A0B2QCB4 I1K6T1
Glyma05g38540.1|PACid:16261168 Glyma05g38540.2|PACid:16261169 XP_003525433.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]