SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma06g04200.1|PACid:16261660 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma06g04200.1|PACid:16261660
Domain Number 1 Region: 126-221
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.44e-24
Family B3 DNA binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma06g04200.1|PACid:16261660
Sequence length 232
Sequence
MVAAIAYEESRRKRVEENKKRMEALNLPLLSQALQKSSPSPKSSPLKQVKHRAIQKEVVV
VRRSSRVANLPSPVYKEIVIDRVTMPRRSLCRSYDKYRDYANRVYASDEAREEALEKAEK
LMSGLESEYPAFIKSMLQSHVSGGFWLGLPVHFCKSNLPKKDEVVTLIDEDGTEYSTIYL
AGKTGLSGGWRGFAIAHDLADGDALIFQLIKRTTFKVYIVRAICPPDDKQLE
Download sequence
Identical sequences K7KSY2
XP_003528263.1.40590 XP_006581238.1.40590 Glyma06g04200.1|PACid:16261660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]