SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma06g12320.1|PACid:16262656 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma06g12320.1|PACid:16262656
Domain Number 1 Region: 1-151,272-319
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.48e-56
Family Tandem AAA-ATPase domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 321-429,525-608
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.36e-41
Family Tandem AAA-ATPase domain 0.0000399
Further Details:      
 
Domain Number 3 Region: 150-271
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 7.72e-36
Family Pre-protein crosslinking domain of SecA 0.0000874
Further Details:      
 
Domain Number 4 Region: 796-907
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 8.76e-23
Family Helical scaffold and wing domains of SecA 0.0012
Further Details:      
 
Domain Number 5 Region: 631-725
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.22e-17
Family Helical scaffold and wing domains of SecA 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma06g12320.1|PACid:16262656
Sequence length 910
Sequence
MRHFDVQIIGGAVLHDGSIAEMKTGEGKTLVSTLAAYLNALTSEGVHVVTVNDYLAQRDA
EWMGRVHRFLGLSVGLIQRGMNSEERRLNYGRDITYTNNSELGFDYLRDNLAGNSEQLVM
RWPKPFHFAIVDEVDSVLIDEGRNPLLISGEASKDAARFPVAAKVAELLIQGIHYKVELK
DNSVELTEEGIDLAEMALETNDLWDENDPWARFVMNAIKAKEFYRRDVQYMVRDGKALII
NELTGRVEEKRRWSEGIHQAVEAKEGLKIQADSVVVAQITYQSLFKLYPKLSGMTGTAKT
EEKEFLKMFQMPVIEVPTNLPNIRKDLPIQAFATARGKWEQVRREVEYMFRQGRPVLVGT
TSVENSELLSGLLREWNIPHNVLNARPKYAAKEAEIVAQAGRKHAITLSTNMAGRGTDII
LGGNPKMLAREIIEDSLLSFLTREDPNVELADEAISQKVLPKVKVGSSSMALLAKTTLMA
KYVSKSEGKSWTYQKAKSFILEAVEMSLSYSLEGLEKLANEESEIYPLGPTVALAYLSVL
KDCEEHCLHEGSEVKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRFMVSLQDEM
FQKFNFDTEWAVRLISKITNDEDLPIEGDAIVKQLLALQINAEKFFFGIRKNLVEFDEVL
EVQRKHVYDLRQLILTGDDESCSQHIFQYMQAVVDEIVFSNIDPLKHPRSWGLSKLLKEF
VTVGGKLLRGGISDDTLLNSLGLVNDLSSVDIVNFSLPNLPAPPNAFRGIRRKSSSLRRW
LAICTDDLIGNGKYQTTSNLLRKYLGDFLIASYLNVVEESGYDERHAKEIERAVLLQTLD
CFWRDHLVNMNRLSSAVNIRSFGHRNPLEEYKIDGCRFFISMLSATRRLTVEALLRYWTS
PMESQELFLS
Download sequence
Identical sequences Glyma06g12320.1|PACid:16262656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]