SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma07g06060.1|PACid:16266361 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma07g06060.1|PACid:16266361
Domain Number 1 Region: 66-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-41
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 502-584
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000334
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma07g06060.1|PACid:16266361
Sequence length 628
Sequence
MEQLQASTDQELNQEIPHFNLPAKIFCRVVNIQLLAEQDTDEVYACIALLPESDQTEPTN
PDPNVSEAPKQKFHSFCKILTASDTSTHGGFSVLRKHATECLPELDMTQSTPTQELAAKD
LHGFEWKFKHIYRGQPRRHLLTTGWSTFVASKRLVAGDAFVFLRGEHGQLRVGVRRLARQ
QSPMPSSVISSQSMHLGVLATASHAVMTRTMFLVYYKPRTSQFIVGLNKYLEAVNNKFSL
SMRFKMRFEGDDSPERRFSGTIVGVGDVSAGWSNSQWRSLKVQWDEPATIPRPDRVSCWE
IEPFVASTALNVTQPAVKDIILIFSIQLLQVSGIMVLPMSLVVPCSLRQKDIINSNPINA
NNSSISTRVRMEGVWPSSPHLNATPNLFSDPNNNNSNNGVSARSLISGYPNVPSRSSDGP
TCDGVEDGKKTENSLDCWLFGVNLTNNCSNVITTPSEREQRGPSSTACETERVQTPNYSL
SNKGQKQIISEASPNQWQNKQATVLSMRTRTKVQMQGVAVGRAFDLTTLSGYDDLIDELE
KLFEIRGELRSQDKWAVTFTDDENDMMLAGDDPWPEFCNMVKRIFICSREDLKKMKCCKL
PASSSEVEEILLSPDSQNRDETQQSHMP
Download sequence
Identical sequences Glyma07g06060.1|PACid:16266361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]