SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma07g16170.1|PACid:16267457 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma07g16170.1|PACid:16267457
Domain Number 1 Region: 111-249
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-38
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 551-624
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000085
Family PB1 domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma07g16170.1|PACid:16267457
Sequence length 658
Sequence
MSLNCGGCGGEEDELYEQLWKACAGPHVEVPRTGQRVFYFPQGHMEQLEVSTNQELNQRI
PLFKLSSKILCRVVNVHLLAEQETDEVYAQITLVPESNQTEPTSPDPCPAELPRPRVHSF
CKVLTASDTSTHGGFSVLRKHATECLPALDMSKSTPTQELVAKDLQGFEWRFKHIFRGQP
RRHLLTTGWSTFVTSKRLVAGDTFVFLRGNNGELRVGVRRIAPLQSSMPSSVISSQSMHL
GVLATASHAVATQTLFVVYYKPRTSQFIVSVNKYLEAINQKCNVGMRFKMRFEGDESPEN
DKRFSGTILGVEDISPHWVNSNWRSLKVQWDEPASFPRPDRVSSWEIEHILACVPTTSSQ
PAVIKNKRPRQASEVPDLEYQGPKFQVVLILGSKMMVMTESKRSDSSSHMRHHNSKSNNN
GISMNQTEASWLSSPQLYQDTTDDNKSILAWPISKPHSERLNNDHFLDQVDKNINKVEAA
TSYRLFGIDLIDHARNNSLSVENASGVASECKTDVNHESDLSKASKEWNQEQLLVSPKET
QSKQVCSRSCTKVQMQGVAVGRAVDLTTLDGYDQLVDELEKMFDIKGQLQHRNKWETVFT
DDEGDMMLVGDDPWPEFCNMVKRIFICSSQDVHKLSSGSKLPISSMGEIVISLNTTET
Download sequence
Identical sequences Glyma07g16170.1|PACid:16267457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]