SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma07g40270.1|PACid:16269382 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma07g40270.1|PACid:16269382
Domain Number 1 Region: 120-249
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-40
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 548-623
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000255
Family PB1 domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma07g40270.1|PACid:16269382
Sequence length 670
Sequence
MASTLKSGGIHTGAINDDLYKELWHACAGPLVTLPREGERVYYFPQGHMEQLEASMYEGL
EQQMPSFNLPSKILCKVVNVHLRAEPETDEVYAQITLLPEADQSEVTSPDDPLPESPRVK
IHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHGNEWHFRHIF
RGQPKRHLLTTGWSVFVSSKKLAAGDAFIFLRQLRVGVRRVMRQQSNVPSSVISSHSMHL
GVLATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEVQSHKLSVGMRFKMRFEGDEIP
ERRFSGTIVGVGDNKSSSVWPDSEWRSLKVQWDEPSSILRPDRVSSWELEPLVSTTLANS
QPTQRNKRARPLILPSTMPDSSLQGIWKSSVESTSFSYCDPQQGRGLYPSPKFNSSATNF
IGFSGNSSVGSPSNKSIYWSNRMENNLESISAIALKEAGEKRQGTGNGCRLFGIQLLENS
NAEGNLQTVTLSGRVGDDRSVPSLDAESDQHSEPSNANRSDIPSVSCDAEKSCLQSPQES
QSKQIRSCTKVHMQGMAVGRAVDLTRFDGYEDLLRKLEDMFNIKTELCGSLKKWQVVYTD
NEDDMMMVGDDPWDEFCSVVRKIFIYTAEEVKKLSPKIRLPMNEKVNPSKQDSEAIVNPE
DQSSNMGPSC
Download sequence
Identical sequences Glyma07g40270.1|PACid:16269382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]