SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma08g01100.3|PACid:16269528 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma08g01100.3|PACid:16269528
Domain Number 1 Region: 528-603
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000932
Family PB1 domain 0.029
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000144
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma08g01100.3|PACid:16269528
Sequence length 650
Sequence
MTDGRVELISGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQQGN
VPSSVISSHSMHLGVLATAWHAILTGTMFTVYYKPRTSPAEFIVPYDQYMESLKNNYTIG
MRFKMRFEGEEAPEQRFTGTIVGIEDADTKRWPKSKWRSLKVRWDETSNIPRPERVSQWK
IEPALAPLALNPLPMPRPKRPRSNVVPSSPDSSVLTREASKVSVDPLPTSGFQRVLQGQE
LSTLRGNFAESNESDTAEKSGVWPPATDDEKIDVSTSRRYGSDSWMSMGRHEPTYPDLLS
GFGAHGDHSSHPSFVDQNGPVANLSRKHLLDREGKHNVLSPWPGVPSSLSLNLLDSNLKG
SAQGGDTAYQVRGNLRYSSAFGEYPVLHGHKVEHSHRSFLMPPPPSTQYESPRSRELLSK
PISGKPCEVSKLKDSDCKLFGISLLSSRPIASEPSLSQRNVTSESVGHMHTASHHQRAIE
NDQKSEHSRGSKPADGLLIDDHEKVLQTSQPHLKDVQAKSHSGSARSCTKVHKKGIALGR
SVDLTKFSDYGELITELDQLFEFGGELTSPQKDWLIVYTDNEGDMMLVGDDPWQEFVAMV
RKIYIYPKEEIQKMSPGTLSSKNEENQSASEGAADAQEIECQLNHSSSDT
Download sequence
Identical sequences I1KP30
Glyma08g01100.3|PACid:16269528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]