SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma08g10550.1|PACid:16270663 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma08g10550.1|PACid:16270663
Domain Number 1 Region: 112-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.15e-48
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 2 Region: 774-854
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000105
Family PB1 domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma08g10550.1|PACid:16270663
Sequence length 905
Sequence
MKLSSPGFSPPPQEGEKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTNRE
VDGHIPNYPSLPPQLICQLHNLTMHADTETDEVYAQMTLQPLNPQEQKGAYLPAELGTPS
KQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPCQELIARDLHGNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQPVMPSSVL
SSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRM
LFETEESSVRRYMGTITGISDLDSIRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
TFPMYPSPFPLRLKRPWPPGLPLFHAGLKDDDFGINSSLMWLRDTDRGLPSLNFQGIGVS
PWMQPRLDPSMVNYQSDMYQAMAAAALQDMWTSNPSKQHPTSSIQFQQPQNFPNQTSPLM
QTQLLQQSPSQQAFPNSQENPHPSPSQSQAQTQTHFQQHLQHQHSFNNQNQHHLLPQQQQ
QPQQPQLQQQQVVDHQQISSVVSTMSQFVSAAQSQSPPMQAISSLGHQQSFSDSNGNPTT
TAIVSPLHSILDSFPQDDTSHLLSLPRSTSWVPVQHSTAWPPSKRVVVDPLLSSGASQCV
LPQVEQLGQPHSTMAQNGIALPAFPGRECTIEGSNDPQNHLLFGVNIEPSSLLMHNGMSS
LKGVSSNSDSPTIPFQSSNYLNTTGPDSSLNPGMTHNIGETGFLQTPENGGQGNPSNKTF
VKVYKSGSFGRSLDITKFTSYPELRSELARMFGLEGELEDPVRSGWQLVFVDQENDVLLL
GDGPWPEFVNSVGYIKILSPQEVQQMGNNELELLNSVPIQRLSNGVCEDPRNLSTGITTV
GSLNY
Download sequence
Identical sequences I1KRX2
Glyma08g10550.1|PACid:16270663 XP_006585093.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]