SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma08g45560.1|PACid:16273934 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma08g45560.1|PACid:16273934
Domain Number 1 Region: 25-191
Classification Level Classification E-value
Superfamily STI-like 3.92e-45
Family Kunitz (STI) inhibitors 0.0000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma08g45560.1|PACid:16273934
Sequence length 213
Sequence
MKNTIFSALFLLCAFTTSYLPSTTAVVDTNGDILQNPGTYFILSVFRPGGGVEFAATGNE
TCPLTVVQTLFGRGFPVILSSQLRIPIIGEGQLFSILFRIVPWCATTPSKWTIVEGLPES
PAVKLTGYDNTVPGEFKIEKANPFHNDYTLLFCPAGEESKCGHIGIHFDDDGNRRLVVSE
ENILRVQFQKFGSSAPDEASLALKKHHVLSVSE
Download sequence
Identical sequences A0A0B2P2G2 I1KYX0
Glyma08g45560.1|PACid:16273934 XP_003532236.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]