SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma09g15670.1|PACid:16275699 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma09g15670.1|PACid:16275699
Domain Number 1 Region: 35-80
Classification Level Classification E-value
Superfamily Chelatase 0.0000000876
Family Cobalt chelatase CbiK 0.064
Further Details:      
 
Domain Number 2 Region: 11-42
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000451
Family B3 DNA binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma09g15670.1|PACid:16275699
Sequence length 143
Sequence
ITECKGLIHQLHKNTIKIGKGWKCYYKYNKLQKGDKIIFTFDVELAEPSIRDFFESCFEQ
GAHHIIVSPFILFPGRHWSQVGLHRIVSYFSINYICGVIEHVLIHVGLRSSTVHSHKKLI
ELWLVCACLSKVQKKNYQFNNLI
Download sequence
Identical sequences Glyma09g15670.1|PACid:16275699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]