SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma09g18790.1|PACid:16275874 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma09g18790.1|PACid:16275874
Domain Number 1 Region: 187-283
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.75e-23
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 4-65
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000171
Family B3 DNA binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma09g18790.1|PACid:16275874
Sequence length 317
Sequence
MSNPVSLKSPDSTRWKIYWTKHDGEIWFQKGWKEYATYYGLDHGHLLFFEYEGTSHFNVH
IFDTSAVEIDYPSNGTHHGKDSSHVEISDDPVEILDEKFSCQKTREKSTVSSPQPTKKMK
AGLTTNVKKRPNVVNLHRHVQIRSIKSQKAKFVKHELDEDESRGIFHTERPKGEQLTSTA
LNRATAFRSENPSFKLVMNPSFIYGDYLEIPPEFAEIYLKKTHAVVILEVLEGRTWPVIC
SAPTITGGWHKFASENHLNVGDVCVFELIQKIQGLAFKVSIFRGAEEPSCPISQASADGF
CEEVFCKDELECGDVTV
Download sequence
Identical sequences Glyma09g18790.1|PACid:16275874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]