SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma09g20280.1|PACid:16275915 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma09g20280.1|PACid:16275915
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-16
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma09g20280.1|PACid:16275915
Sequence length 197
Sequence
KIPNKFTREYGVNLSNPVFLKPPDGIEWKIFWTKHDGDIWFQKGWKEFATYYSLSHKYLV
LFKYQETSHLEVHIFDQSALEVDYPFCGIKIEHENLDHVSNDSVEVSDDSIEVLDELTPS
QKKTRLKSTSCSRPRKKLNTGPSEVFEESSNLPQHVQIKGEQSQGTNLGMSSDKQVLDES
VRHCDLICAGLKISGNS
Download sequence
Identical sequences Glyma09g20280.1|PACid:16275915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]