SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma11g13200.1|PACid:16283722 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma11g13200.1|PACid:16283722
Domain Number 1 Region: 89-186
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000104
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma11g13200.1|PACid:16283722
Sequence length 190
Sequence
MEEENEQEQAAAQHVEDCDIEEEEDSSSKDENYDGSDSDDDEESEEEFSAGFKRQSHHRR
ACKRESASNSNPNAEDLLPEYVFDPEMCIQPENHFFKAKLYKTRPNELDISINLLGDCHH
NLAQQTFIKTKYQQVSGRVCRWKDYRIYIKGWDSFCRRNEIERDDTCFCEVISGEEQGVR
TLRVHVARRR
Download sequence
Identical sequences I1LJK4
Glyma11g13200.1|PACid:16283722 Glyma11g13200.2|PACid:16283723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]