SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma11g13220.1|PACid:16283726 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma11g13220.1|PACid:16283726
Domain Number 1 Region: 326-430
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-21
Family B3 DNA binding domain 0.007
Further Details:      
 
Domain Number 2 Region: 29-122
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-17
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma11g13220.1|PACid:16283726
Sequence length 434
Sequence
MRDFSFHSNDLLILQGNNRERWKMDYHQDNPAVFFTTIKNTKQLKVPEEFLKHLNKDLWS
NSVLIGPSGDKWQVTILKKGNNVYMDNGWSQFLKDNSVVLDEFLLFTYHGGNCFYVQIFG
GNGLERLCRKEAREEQAATPQFFDLPFSNKASISDGCEIKKTRQEQASAPSLARTNKSKQ
RKTFVGSSHLHESNSYKKDLPSSNKGTLSKGCEIKKTRQEQAATPSFLRPNKIKQRKTSA
RSSNLNESKSCQEGQERVATLSWARTNNYNSTQRKTSAGSSHLHESNSSKEDLPFSNKAS
LSKDFPKPQSSINIECSEACKLAESFTSRNPHWKHLLTKCNLERCILLIAAEFARKYIPE
ALEQIYLWNSEGKSWEVRVHYFRNRNTWYAAFKRGWERFVRDNKLMKGDTCIFEVEEEQG
HWSVHIFRTGCAPH
Download sequence
Identical sequences I1LJK8
Glyma11g13220.1|PACid:16283726 XP_003537917.2.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]