SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma11g13230.1|PACid:16283729 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma11g13230.1|PACid:16283729
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-18
Family B3 DNA binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma11g13230.1|PACid:16283729
Sequence length 192
Sequence
KVPEEFLKHLNEDLSSNAVLIGPSGDKWQVTILKKGNNVYMNNGWSQFLKDNSVVLDEFL
LFTYHGGNCFYVQIFCGNGLERLCLKETRQEQAVTPQFLDLFFSNKDTLSNGCNTKKTIQ
KQIPTPSLMRTSKYKQRKTFFGSSHLHESKSYQKKEHVNNITDLTLIFPLTPNIYHFLTF
CCPYFLRTSQSL
Download sequence
Identical sequences Glyma11g13230.1|PACid:16283729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]