SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma11g13350.1|PACid:16283742 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma11g13350.1|PACid:16283742
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.08e-18
Family B3 DNA binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 257-331
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000255
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma11g13350.1|PACid:16283742
Sequence length 336
Sequence
MTTGAERYPDFFKVFLPERHSERMLIPNAFVRLPQSQGRIPEDVILRNISGRVWQVKTRY
IGEKLYFDDGWNAFHEENCLGHADFLVFKHDRSNEFKVLILESSTQCQKPVVKMEEENEQ
EQAAAQHAEDCDIEEEEDSSSKDENYDDDSDDSDFDDDEESKEEFGAGFKSQSHHRRACK
RETASSSNPDAEDPLPEYVFDPEMCIQRENHFFKAKLYRTRPNELHIPGNSIQEFSLTFP
ENYVTLICCQPCQRKDIPMNELGDYHHNLTQQTHIRKKYQEVTGRVCRWQDRICIKGWAS
FSKRNKIERNDTCFCEVISGEDQVVRTLEVHVARRR
Download sequence
Identical sequences A0A0B2PA17 K7LPD9
XP_003539036.1.40590 XP_006590924.1.40590 XP_006590925.1.40590 XP_006590926.1.40590 XP_006590927.1.40590 XP_014619491.1.40590 XP_014619492.1.40590 XP_014619493.1.40590 Glyma11g13350.1|PACid:16283742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]