SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma11g31270.1|PACid:16285031 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma11g31270.1|PACid:16285031
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000126
Family B3 DNA binding domain 0.0027
Further Details:      
 
Weak hits

Sequence:  Glyma11g31270.1|PACid:16285031
Domain Number - Region: 189-255
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0403
Family PHD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma11g31270.1|PACid:16285031
Sequence length 537
Sequence
MQDVKGNEWTFQFRFWPNNNSRMYVLEGVTPCIQAMQLCAGDTVTFSRIDPGGKLVMGFR
KASNSTDTQDASTSAQSNSAKGTISSGTENLPSGSNHANLLHSLTGNVETHLNGHTEHLH
LGTGTAGLLKTENNEMTNSSSPQQQISVLEKKRTRNIGPKSKRLLIDNEDAMELKLTWEE
AQDLLRPPPSVKPNIVTIEDQVFEEYDEPPVFGKRTIFSACSSGGKEQWAQCDDCSKWRK
LPVDALLPPKWTCSENVWDSSRCSCSVPEELSSKELENLLKTNKDFKKRRIAESSKSIQE
HEASGLDALASAAVLGENLVDTAESSAGATTKHPRHRPGCSCIVCIQPPSGKGRHKPTCT
CNVCMTVKRRFKTLMLRKKKRQSEREADTAQKDQTLLKDEPDTNGAPRDDTSRLEKEVGL
NKSQHQVGESSTGQIDLNSHPNREDMQVETTGLNMSSHLEPATNHTVGEFMDKNDLRRSF
NNEVQTGQNSSLHTPPQSSGEGQRYFSDGRCFASIVWNQERKDEVHSQPNQSQNNLS
Download sequence
Identical sequences Glyma11g31270.1|PACid:16285031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]