SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma12g05250.1|PACid:16286475 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma12g05250.1|PACid:16286475
Domain Number 1 Region: 295-395
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-24
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-23
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma12g05250.1|PACid:16286475
Sequence length 441
Sequence
MPHPSFHKLLLPSTVQPNQQLRLPDNFMRKYGGELLPIVTLSVPDGSVWRVGLKKADNKY
WFLDGWKEFVKHYSISIGYLLVFKYEGKSSFSVHIFNLATSEINYQSATRSSNEGLHFTN
RLKLFEEIEDEDSIEISDSSPSHLAPSSLQNQALTGSVDKMMPGKSYTPPALQNLFNGSK
LNSINWGEGGNAHSSRIANSLDNRLTRDIGLQFNAVEFKRSTEELKLRASMEERMKKTTR
KKRKSVCASADGQDPSAEHEEEVEMRLRFYESASARKRTVTAEERERAINAAKAFEPPNP
FCRVVLRPSYLYRGCIMYLPSCFAEKHLNGVSGFIKLQISNGRQWPVRCLYRGGRAKLSQ
GWFEFSLENNLGEGDVCVFELLRMKEVVLQVTVFRVIEDVGLLSPPLQQNQNMSSAKMLN
TPLQQHLTSTKMVRNQQQVHS
Download sequence
Identical sequences I1LQ96
Glyma12g05250.1|PACid:16286475 XP_006592124.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]