SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma12g05260.1|PACid:16286479 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma12g05260.1|PACid:16286479
Domain Number 1 Region: 16-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-16
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma12g05260.1|PACid:16286479
Sequence length 206
Sequence
MGDFSLHENNMDYHQDNLAVFFTIIKNTKLLKVPEEFLKHLNEDLWSNEVLIGPSGDKWL
VTIWKKGNDVYMKNGWSLFLKDNSVVLDEFFLFTYHGGNCFHVQIFGGNGLERLCLEETR
QEQAAIPQFFDLPFSNNASLFDGYEIKKTRQEQASIPSLARTKNKSKQRKTSAGSLHHHE
SNFLDSNVSWECLSKSRHTLLRHSFI
Download sequence
Identical sequences Glyma12g05260.1|PACid:16286479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]