SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma12g29720.1|PACid:16288327 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma12g29720.1|PACid:16288327
Domain Number 1 Region: 104-210
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-29
Family B3 DNA binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma12g29720.1|PACid:16288327
Sequence length 700
Sequence
MKETDKSLDPQLWHACAGGMVQMPPVNSKVFYFPQGHAEHAQSNVDFGAARIPIPPLILC
CVAAVKFLADPETDEVFARLRMVPLRNSELDYEDSDGNGAEGSEKPASFAKTLTQSDANN
GGGFSVPRYCAETIFPRLDYSAEPPVQTVIAKDVHGEVWKFRHIYRGTPRRHLLTTGWSS
FVNQKKLVAGDSIVFLRAENGDLCVGIRRAKRGGVGGAEGPCGWSSSGGGLGPGPGLGLG
PGPGPYGAFSGFLREESKVVRSGRPKVSGESVREAVTLAASNQPFEVVYYPRANTPEFCI
RTSAVRGAMRIQWSSGMRFKMPFETEDSSRISWFMGTIASVQLLDPIRWPNSPWRLLQVT
WDEPDLLHNVKRVSPWLVELVSNVPIIHLAPFSPPRKKLRFPQHPEFPLDFQFPIPSFSG
NPFGSSTSSPLCCLSDNAPAGIQGARHAQIGISLSDLHLNNKLQLGLLPTNVHQLNLHTG
ICNGNITNHGKSKESLSCLLTMGNSNKSLEKSDHVKRHQFLLFGQPILTEQQISRSSSDV
LSQNFTVTDDENKEKKEKGFLSDSQSSVSPGKSSSTTEFSWQVGSDTSHCKVFIESEDVG
RTLDLSCLGSYEELYMRLANMFGIERSEMLSHVLYRDAAGALKQTGEEPFSEFMKTAKRL
TILTDSNNKDSRRVWITGIRNAEHGLDTASNKTGPLGIFA
Download sequence
Identical sequences I1LTK0
Glyma12g29720.1|PACid:16288327 XP_003540185.1.40590 XP_006592702.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]