SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma13g02410.1|PACid:16289434 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma13g02410.1|PACid:16289434
Domain Number 1 Region: 109-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-29
Family B3 DNA binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma13g02410.1|PACid:16289434
Sequence length 551
Sequence
MSPPQPSRVDPKIWRACAGAAVQIPKLHSRVYYFPQGHMEHASPSHYLSPLIRSLPFVPC
HVSSLDFLADPFSDEVFAKFLLTPLSQSQQQPFQNDTKEARNDDDDEDRENNGVVSFAKI
LTPSDANNGGGFSVPRFCADSCFPPLDFRADPPVQLLSVADIHGVEWRFRHIYRGTPRRH
LFTTGWSKFVNHKKLVAGDTVVFVKDSDGIVSVGIRRAARFAAAIETPPPAEREGFSRST
TGRVTAEAVAAAAESAARNAPFEVVYYPRTGFADFVVSAEVVEESMKCAWVGGMRVKISM
ETEDSSRMTWYQGTVSSACASENGPWRMLQVNWDEPEVLQNAKQVSPWQVELVSPPFALH
TVFSPNKRLRADQGSGLLSNREQDPFFPMPGFSNSAMGHMTGFPNSTVGQMDKPLLSYES
FPAGMQGARHDLYSPLSFSNFLNDNSYLYMGSGSFGNNPVQSLGTVTTELNMSSSQSDDL
SPHSQSSFHSFGTEFTGTRNCDTKVGPGSILLFGKIIQPAESDLHDADCMERDGSRGSNK
LKTVEACYFSK
Download sequence
Identical sequences I1LW27
Glyma13g02410.1|PACid:16289434 XP_003543780.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]