SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma13g11750.1|PACid:16290325 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma13g11750.1|PACid:16290325
Domain Number 1 Region: 390-531
Classification Level Classification E-value
Superfamily BRCA2 helical domain 8.76e-38
Family BRCA2 helical domain 0.00063
Further Details:      
 
Domain Number 2 Region: 532-659
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.54e-36
Family Single strand DNA-binding domain, SSB 0.00019
Further Details:      
 
Domain Number 3 Region: 664-693,809-892
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.4e-23
Family Single strand DNA-binding domain, SSB 0.0081
Further Details:      
 
Domain Number 4 Region: 693-809
Classification Level Classification E-value
Superfamily BRCA2 tower domain 9.42e-20
Family BRCA2 tower domain 0.0023
Further Details:      
 
Domain Number 5 Region: 901-1053
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000394
Family Single strand DNA-binding domain, SSB 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma13g11750.1|PACid:16290325
Sequence length 1056
Sequence
MRTKKTMCTWQILSNSPNNFHWQRITTTTTHQHASPPSFPLPSMQDLLRQGTPTLPLQDD
ARVLDDGFGFSNSLFTTGSGKKVTISSSGLVRAKTLLDTIDSSIQSPHRTNKLHAIGEKR
KQRQEEEDESPQLKLHRVIDSPSVGGGCRALKKNGFEETDAYKQAPIKFHTAGGRSISIS
KDALQRAQSLLGDVGDLFEGGDAGSSMFSFPFERQADTAASSQRGDCNTPLVRRVLTPAR
SNCTAKSFTFPLQSSRQRELPPKFPCEGDGNNLITEFDAVGEESGYNSLKSTNACGQKKP
LYGWNQAPHSAVHDSSLNGFSSKIDTHAVSIRRPLVDVSNTTNPDQTNNRQPASGKRRLG
LRVTVSPFKKPRSSQISVPLEQDIGKSPHDLSQLSSGVSGCKREVSIRYPFQYPRMHIKD
FFVVPPLQEKAHFPNLSRQVTSVNAEKYVFYERSGDNGMGAEAFVHLLAHHGASMHFATK
EWVTNHYKWIVWKLACYERYYPASSAGKFLTVTNVLEELKYRYEREVNHGHRSTIKKILE
GDAPPSSMMILCISSICSSHATESGTCFETQNGTQKAAAVKVELTDGWYLMNAILDVPLS
KQHAAGRLFVGQKLRISRAGLCGWNGPVSPLEVSSTVSLLLHINGTYRAHWAERLGFCKI
AGPPLAFRCIKSNGGLVPQTLAGITRIYPILYMERLSSGRSVVMSERMENKMMELYNQRR
SAVVDGIISEYQKERPHIYYDSDSEGAKIYNMLETAEEPEFLMADMSPEQLNSFATYKAK
LNAIRQSEMDKSIEKALKDAGLGSRQVTPFMRLRVVGLTYKTRQDKPKEGIVAIWNPTET
QRQELVEGGAYAISGLMPSSSDSDILHLDTRGSSTKWLPLSYNSRKQFKPFFCNRKSIPL
TSLGDIPLSNEFDITAYVVHVGGVYISNQQKKQWVFVTDGSIMNGLQSEKLIDSLLAICF
CSPLIDHDSFPPINYNLAGSTVGFCNLIKKEKDHTNHIWVADANENSAYYLNFDSTNCSH
LRNAASSVRAWANHSSLIIEKLKEKVMYVVGEDCKA
Download sequence
Identical sequences Glyma13g11750.1|PACid:16290325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]