SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma13g29320.1|PACid:16291978 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma13g29320.1|PACid:16291978
Domain Number 1 Region: 112-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-49
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 763-838
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000105
Family PB1 domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma13g29320.1|PACid:16291978
Sequence length 896
Sequence
MRLSSAGFSPPPQEGENRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTNKE
VDAHIPNYPSLPPQLICQLHNMTMHADAETDEVYAQMTLQPLNPQEQKEAYLPAELGTPS
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVL
SSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRM
LFETEESSVRRYMGTITGISDLDPVRWQNSHWRSVKVGWDESTAGDRQPRVSLWEIEPLT
TFPMYPSPFPLRLKRPWPPGLPSFHAGMKDDDFGPNSPLLWLRDPDRGLPSLNFQGIGIN
PWMQPRFDPTMLNMQTDMYQAAAVQDMRSLDPSKQHSASLLPFQQPQNFPNRTAALMQAQ
MLQQSQPQQIFGNTQENQHSPQSQAHLQQHLQHQHSFNSQHHHHHQQQQQRQQHQVVDNQ
QISSAVSTMSQFVSAPQPQSPPMQVISSMCQQQNFSDSNGNTVTTIVSPLHSILGSFPQD
ETSHLLNLPRTSSWIPVQNSSGWPSKRVAVDPLLSSGASQCVLPQVEQLGQPQSTMSQNA
ISLPPFPGRECSIDQEGSNDPQNHLLFGVNIEPSSLLMPNGMSSLKGVCGNNGSSTLPYQ
SSNYLNTTTRTDSSLNHGMTPNIGDSGFLQCLEEAGQGNPLNKTFVKVYKSGSFGRSLDI
TKFSSYHELRGELARMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDGPWPEFVNSVWCI
KILSPQEVQQMGNNGLELLNSFPIQRLSNGICDDYVSRQDPRNLGTGITTVGSLDY
Download sequence
Identical sequences I1M1J4
XP_006594517.1.40590 Glyma13g29320.1|PACid:16291978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]