SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma13g35050.1|PACid:16292664 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Glyma13g35050.1|PACid:16292664
Domain Number - Region: 5-27
Classification Level Classification E-value
Superfamily Ferredoxin thioredoxin reductase (FTR), catalytic beta chain 0.0523
Family Ferredoxin thioredoxin reductase (FTR), catalytic beta chain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma13g35050.1|PACid:16292664
Sequence length 47
Sequence
MKFLFQCPCCSCFCFMKPKQGKAKVKEVKETKVEEKKVEEKIEEKKD
Download sequence
Identical sequences K7M2A7
Glyma13g35050.1|PACid:16292664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]