SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma13g40030.1|PACid:16293233 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma13g40030.1|PACid:16293233
Domain Number 1 Region: 105-211
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-29
Family B3 DNA binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma13g40030.1|PACid:16293233
Sequence length 670
Sequence
MKETDKSLDPQLWHACAGGMVQMPPVNSKVFYFPQGHAEHAQSNVDFGAARIPIPPLILC
RVAAVKFLADPETDEVFARLRLVPLRNSELDYEDSDANGEAEGSEKPASFAKTLTQSDAN
NGGGFSVPRYCAETIFPRLDYSAEPPVQTVIARDVHGEVWKFRHIYRGTPRRHLLTTGWS
SFVNQKKLVAGDSIVFLRAENGDLCVGIRRAKRGGVGGPEGPCGWSSYGSGGLGLGPYGA
FSGFMREESGRAKVSGESVREAVTLAASNQAFEVVYYPRANTPEFCIRTSAVRGAMRIQW
CSGMRFKMPFETEDSSRISWFMGTIASVQVLDPIRWPNSPWRLLQVSWDEPDLLHNVKRV
SPWLVELVSNVPIIHLAAFSPPRKKLRFPLDVQFPIPSFSGNPFGSSSSSSPFCCLSDNA
PAGIQGARHSQIGISLSDLHLNNKLQLGLLPTKVHQLNLHAGISNAKSKESLSSLLSMGN
SNMTLEKSDHVKRHHFLLFGQPILTEQQISRSSSDVATDDENKEKKKKGFLSDSQSSVSP
GNLSSTAEFSWQLGSDTSHCKVFMESEDVGRTLDLSCLSSYQELYMRLANMFGIERSDML
SHVLYCDSSGALKQIGEEPFSEFMKTAKRLTILTDSNNKDSRRVWITGTRNAEHGLDAAS
NKTGPLSIFA
Download sequence
Identical sequences I1M4J8
XP_003543470.1.40590 Glyma13g40030.1|PACid:16293233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]