SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma13g40310.1|PACid:16293267 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma13g40310.1|PACid:16293267
Domain Number 1 Region: 167-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-37
Family B3 DNA binding domain 0.0083
Further Details:      
 
Domain Number 2 Region: 670-746
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000481
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma13g40310.1|PACid:16293267
Sequence length 796
Sequence
MKGLLGSFLVVLVLVEGLTHNNTMTSEAEKSASCNEECEKGAAFALSSSTCSSSGSSSAR
VSSSYLELWHACAGPLTSLPKKGNVVVYFPQGHLEQASSFSPFSPMEMPTYDLQPQIFSR
VVNIQLLANKENDEVYTQVTLLPRAEYLEGKELEELGTDEEGNEATPTKSTPHMFCKTLT
ASDTSTHGGFSVPRRAAEDCFPRLDYKQQRPSQELVAKDLHGVEWKFRHIYRGQPRRHLL
TTGWSIFVSQKNLVSEMQFSFLVSRIVILGENGELRLGIRRAARPRNGLPESIVGSQSYY
PNFLSSVANAISAKSMFHVFYSPRASHADFVVPYQKYIKSIKNPVTIGTRFKMKFEMDES
PERRCTSGIVTGMSDLDPYKWPKSKWRCLMVRWDEDIEISHQDRVSPWEIDPSSSLPPLS
IQSSRRLKKLRPGLQAATPSHLTTAGGSGFMDSEESVRSSKVLQGQENTGFMSLYYGCDK
VTKQPEFEIRSPSHPNLASTGVRKISAAEFMRVHPSSFAGFSETNIVPRVLHGQEISVGA
KPNVSYSNNNLHQATKPSFHSLGPEVIQTAYFPYGDIHNAGQGSSILCSKPTNFQRENIP
FNTPSTQSGIMRNEKLQDNISGTASLGANMRIPKDDNFKGQVKACKLFGISLSGETTAQN
LQNSAKRSCTKVHKQGSLVGRAIDLSRLSSYNDLLIELERLFSMEGLLIDPNKGWRILYT
DSENDIMVVGDDPWHEFCDVVSKIHIHTQDEVEKMTIGMMINDDTQSCLEQAPVTMEASK
SSSVGQPDSSPTVVRM
Download sequence
Identical sequences Glyma13g40310.1|PACid:16293267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]