SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma13g44360.1|PACid:16293749 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma13g44360.1|PACid:16293749
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.15e-27
Family N-terminal domain of MutM-like DNA repair proteins 0.0014
Further Details:      
 
Domain Number 2 Region: 146-232
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.93e-25
Family Middle domain of MutM-like DNA repair proteins 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma13g44360.1|PACid:16293749
Sequence length 399
Sequence
MPELPEVEAARRAVEYNCVGKRITKCVVADDSKVIHGVSPSDFQASVLGKLIVAAHRKGK
NMWLQLDSPPFPSFQFGMAGAIYIKGAAVTNYKRSAVKDEDEWPSKYSKIFIELDDGLEL
SFTDKRRFAKVRLLKDPTSVPPISELGPDALFEPMTLEKFTESLHKKKTEIKALLLDQSF
ISGIGNWVADEVLYQARIHPRQVASSLSNESCSNLSKCIKEVIEKAIEVGAESSQYPTNW
IFHSREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLSGSLDVKETGKPNKRQASKKVR
VDDDTEKPTNGEVDDLGSVKSKKGTKAGAKGRKPSKKKKSGGSDEDKDSSDVGTDYDSDQ
VEKKNPGNVASRKQAGGEKQSNRRVQSNQTSWSAKRKAK
Download sequence
Identical sequences I1M5V4
Glyma13g44360.1|PACid:16293749 XP_003542122.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]