SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma14g08630.1|PACid:16294854 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma14g08630.1|PACid:16294854
Domain Number 1 Region: 21-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-19
Family B3 DNA binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 271-356
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000235
Family B3 DNA binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma14g08630.1|PACid:16294854
Sequence length 410
Sequence
MVGQNCDGCRSWEEDIYWSHFQFLHFVQFLHADYDQHLALPKTFSDNLKKKLPENVTLKG
PGGVMWNIGMTTRDDTLYFGHGWEQFVKDHCLKENDFLVFKYNGGSLNKKRDTDNDSLEE
GNIPSNAGVECALHEKSAHVNGTKEPIDVPPETPPTENTFNAGVESSGVEQFTPDGGVTL
AAVPSETANGKRIRNIVSAVKHVHTKRKGRPAKWHVRERTLDWVAALEAEPVSASRSGTY
EVYKSNRRPVTDDETRKIESLAKAACTDDSIYVVMKPTHVYKRFFVSIRGTWIGKHISPS
SQDVILRMGKGEWIARYSYNNIRNNGGLTGGWKHFSLDSNLEEGDACVFKPAGQINNTFV
IDMSIFRVVPETVPLTPMSRGTRTGTRTGTGRRGRKPATMKSIQTQLSSP
Download sequence
Identical sequences C6TKM0
Glyma14g08630.1|PACid:16294854 NP_001239771.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]